Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53690 59 / 3e-12 RING/U-box superfamily protein (.1) AT4G19670 52 / 1e-09 RING/U-box superfamily protein (.1.2) AT3G14250 52 / 1e-09 RING/U-box superfamily protein (.1) AT2G25360 47 / 5e-08 RING/U-box superfamily protein (.1) AT2G21420 47 / 7e-08 IBR domain containing protein (.1) AT3G45470 46 / 1e-07 IBR domain containing protein (.1) AT5G37560 45 / 3e-07 RING/U-box superfamily protein (.1) AT3G45580 44 / 9e-07 RING/U-box protein with C6HC-type zinc finger (.1) AT5G60250 44 / 1e-06 zinc finger (C3HC4-type RING finger) family protein (.1) AT2G25370 43 / 2e-06 RING/U-box superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022063 [exp] 119 / 4e-35 AT3G53690 175 / 3e-53 RING/U-box superfamily protein (.1) Lus10036127 [exp] 51 / 3e-09 AT5G60250 338 / 9e-108 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10022064 [exp] 45 / 1e-07 AT3G14250 78 / 2e-18 RING/U-box superfamily protein (.1) Lus10000412 [exp] 45 / 6e-07 AT3G14250 228 / 9e-73 RING/U-box superfamily protein (.1) Lus10026104 [exp] 44 / 8e-07 AT3G14250 240 / 1e-77 RING/U-box superfamily protein (.1) Lus10042610 [exp] 44 / 1e-06 AT3G53690 113 / 9e-17 RING/U-box superfamily protein (.1) Lus10024093 [exp] 43 / 2e-06 AT3G14250 209 / 2e-66 RING/U-box superfamily protein (.1) Lus10036128 [exp] 40 / 2e-05 AT5G60250 410 / 1e-136 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10038341 [exp] 40 / 3e-05 AT4G19670 607 / 0.0 RING/U-box superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G064400 [exp] 56 / 6e-11 AT3G53690 273 / 1e-89 RING/U-box superfamily protein (.1) Potri.003G187700 [exp] 49 / 1e-08 AT3G14250 242 / 8e-79 RING/U-box superfamily protein (.1) Potri.019G093600 [exp] 44 / 1e-06 AT3G53690 158 / 7e-47 RING/U-box superfamily protein (.1) Potri.001G037200 [exp] 42 / 3e-06 AT3G14250 240 / 3e-78 RING/U-box superfamily protein (.1) Potri.009G150100 [exp] 42 / 3e-06 AT5G60250 378 / 6e-124 zinc finger (C3HC4-type RING finger) family protein (.1) Potri.013G120300 [exp] 40 / 3e-05 AT3G53690 158 / 7e-47 RING/U-box superfamily protein (.1) Potri.017G050100 [exp] 40 / 3e-05 AT4G01020 1719 / 0.0 helicase domain-containing protein / IBR domain-containing protein / zinc finger protein-related (.1) Potri.006G123500 [exp] 39 / 5e-05 AT3G53690 163 / 1e-48 RING/U-box superfamily protein (.1) Potri.006G104700 [exp] 38 / 0.0001 AT5G60250 424 / 4e-141 zinc finger (C3HC4-type RING finger) family protein (.1) Potri.015G117600 [exp] 36 / 0.0005 AT4G19670 661 / 0.0 RING/U-box superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042609 pacid=23182057 polypeptide=Lus10042609 locus=Lus10042609.g ID=Lus10042609.BGIv1.0 annot-version=v1.0 ATGGTGAAGTGGCTTGCTGGATTGAAGAAGTGGAGAAAGTGCCCTCATTGCAGCTTGTACGTTGAAAAACTACGCTTTCACTGCAACTATATTAAATGCA GGTGCGGAAAAGCATTTTGTTACGCGTGCGGTTCTCCTTACCGCAACGGGGTACATGTCAACACAACCATGACCAGTGGCTGTGTAGAAAAATATTAG
AA sequence Show only first row Show all	>Lus10042609 pacid=23182057 polypeptide=Lus10042609 locus=Lus10042609.g ID=Lus10042609.BGIv1.0 annot-version=v1.0 MVKWLAGLKKWRKCPHCSLYVEKLRFHCNYIKCRCGKAFCYACGSPYRNGVHVNTTMTSGCVEKY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53690			RING/U-box superfamily protein...		Lus10042609 [exp]	0	1

Compare expression of checked genes

Lus10042609 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.