Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22600 117 / 7e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 104 / 8e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 100 / 3e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 82 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13820 62 / 7e-13 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G55260 59 / 4e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G43720 59 / 5e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G09370 57 / 6e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22580 57 / 7e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44290 56 / 5e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022065 [exp] 179 / 6e-58 AT3G22600 143 / 4e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 115 / 3e-33 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 114 / 1e-32 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 112 / 9e-32 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042612 [exp] 107 / 3e-29 AT3G22600 121 / 9e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10022066 [exp] 103 / 5e-28 AT3G22600 121 / 2e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 99 / 1e-26 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10041197 [exp] 96 / 3e-25 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010573 [exp] 90 / 4e-23 AT3G22600 117 / 5e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G085400 [exp] 125 / 7e-37 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 121 / 2e-35 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211800 [exp] 114 / 2e-32 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050500 [exp] 110 / 5e-31 AT3G22600 129 / 2e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050400 [exp] 102 / 8e-28 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050300 [exp] 102 / 2e-27 AT3G22600 117 / 3e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085300 [exp] 97 / 5e-26 AT3G22600 66 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211900 [exp] 94 / 2e-24 AT2G48130 89 / 3e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 63 / 1e-12 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G210100 [exp] 57 / 1e-10 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10042611 pacid=23181768 polypeptide=Lus10042611 locus=Lus10042611.g ID=Lus10042611.BGIv1.0 annot-version=v1.0 ATGGCCGTGATTAGGAATTTGTCAATTCTGGTCATCTCTCTTGCCGTCGTCGGGACCGCTCTGTTTCCGACAGGAGCCACGGCGCAGTCGAACAGCTGCA CCAGCACGCTTGTGAGCCTCTCCCCTTGCCTTAATTACATCACCGGAAACTCTTCCTCCCCGTCTTCTTCCTGCTGCGCCCAGCTCGGCACCGTCGTCAA GTCCCAGCCGGAATGCCTCTGCCAGGTCATCAGCGGCGGCGGCGGCAACCTCGGTATTAACGTGAACCAGACTCAAGCTCTGGCTCTTCCCGCTGCCTGT AAAGTCCAGACCCCACCTACCAGTCAATGCAATGCGGCCGGATCGCCATCTGGGTCACCGAAGTCACCGTCAGGGACAGGAGGCGGGTCAACGGGTTCAT CACCGGACGGGACATCATCGTCCTCTTCTGCCGATGGGAGCTCTGCAAAGTTAACATTTTCACTGGTCTTCCTGATGCTCTTTGCTGCTTCCTACTCTTC AATCTAA
AA sequence Show only first row Show all	>Lus10042611 pacid=23181768 polypeptide=Lus10042611 locus=Lus10042611.g ID=Lus10042611.BGIv1.0 annot-version=v1.0 MAVIRNLSILVISLAVVGTALFPTGATAQSNSCTSTLVSLSPCLNYITGNSSSPSSSCCAQLGTVVKSQPECLCQVISGGGGNLGINVNQTQALALPAAC KVQTPPTSQCNAAGSPSGSPKSPSGTGGGSTGSSPDGTSSSSSADGSSAKLTFSLVFLMLFAASYSSI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10042611 [exp]	0	1
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10022065 [exp]	1.0	0.9775
AT1G05450			Bifunctional inhibitor/lipid-t...		Lus10010575 [exp]	1.4	0.9663
AT2G23810		TET8	tetraspanin8 (.1)		Lus10023216 [exp]	6.3	0.9291
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10006909 [exp]	6.3	0.9117
AT2G18360			alpha/beta-Hydrolases superfam...		Lus10041747 [exp]	7.5	0.9312
AT4G34710		SPE2, ADC2, ATA...	arginine decarboxylase 2 (.1.2...		Lus10035463 [exp]	8.8	0.9058
					Lus10033358 [exp]	8.9	0.9101
AT1G32170		XTH30, XTR4	xyloglucan endotransglycosylas...		Lus10010427 [exp]	10.2	0.9218
AT2G39200		ATMLO12, MLO12	MILDEW RESISTANCE LOCUS O 12, ...		Lus10040388 [exp]	11.0	0.9027
AT3G55090		ABCG16	ATP-binding cassette G16, ABC-...		Lus10001971 [exp]	11.4	0.8912

Compare expression of checked genes

Lus10042611 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.