Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22600 118 / 2e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 102 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 100 / 3e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 95 / 2e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13820 69 / 9e-15 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G55260 70 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G43720 69 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G64080 65 / 6e-13 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G09370 64 / 6e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G44290 62 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022066 [exp] 223 / 2e-74 AT3G22600 121 / 2e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 158 / 7e-49 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 133 / 3e-39 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 132 / 6e-39 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042611 [exp] 115 / 2e-32 AT3G22600 142 / 1e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 105 / 2e-28 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10041197 [exp] 100 / 3e-26 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039349 [exp] 97 / 2e-25 AT3G22600 119 / 9e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010573 [exp] 97 / 5e-25 AT3G22600 117 / 5e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G050400 [exp] 129 / 2e-37 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 127 / 6e-37 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 124 / 1e-35 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211800 [exp] 120 / 3e-34 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050500 [exp] 116 / 7e-33 AT3G22600 129 / 2e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050300 [exp] 106 / 2e-28 AT3G22600 117 / 3e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085300 [exp] 103 / 1e-27 AT3G22600 66 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211900 [exp] 99 / 7e-26 AT2G48130 89 / 3e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 66 / 2e-13 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G210100 [exp] 61 / 1e-11 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10042612 pacid=23182026 polypeptide=Lus10042612 locus=Lus10042612.g ID=Lus10042612.BGIv1.0 annot-version=v1.0 ATGGCGATGTACCACGGCGCCACAGCGCAGTCGGGAGGATGTACTAGCGCACTGATAAGCTTGGCACCCTGCCTCAACTATGTCTCGGGGAACTCATCAA CTCCCTCGAGTACTTGCTGCTCACAACTGGCCAGTGTAGTTTCTTCGCAGCCGCAGTGTCTCTGCCAGTTGGTTAACGGTGGCGGGTCCTCTCTGGGGAT CGTCGTCAACCAAACTCAAGCTCTCGAGCTCCCTTCCGCTTGTAGCGTAACCACCCCTTCTGTTAGCCGATGCAATACTGGGAATGCCCCATCGGATTCA CCTGGGGCAGGAGCAGGAACTGGAGGGAGCCCACCGGCGTCGAATGACAAACCAGGGATGACGACCACAGCTGGGGGAGCTCCGCCGAGCAGTACTCCTT CAGATAACGGTGGTTCTGCTAACACGGTTCCCACGACGATTGGTTCGTCGGATGCGATTTTTGTCGGGATGAAGCTACATGTCACGCTTTTCTTACTGCT TGTTGCTCCGCCGATCAGTACTCCTTCAGATAACGGTGGTTCTGCTAACACGGTTCCCACGACGATTGGTTCGTCGGATGCGATTTTTGTCGGGATGAAG CTACATGTCACGCTTTTCTTACTGCTTGTTGCTTCCTGTGCGTTGTGA
AA sequence Show only first row Show all	>Lus10042612 pacid=23182026 polypeptide=Lus10042612 locus=Lus10042612.g ID=Lus10042612.BGIv1.0 annot-version=v1.0 MAMYHGATAQSGGCTSALISLAPCLNYVSGNSSTPSSTCCSQLASVVSSQPQCLCQLVNGGGSSLGIVVNQTQALELPSACSVTTPSVSRCNTGNAPSDS PGAGAGTGGSPPASNDKPGMTTTAGGAPPSSTPSDNGGSANTVPTTIGSSDAIFVGMKLHVTLFLLLVAPPISTPSDNGGSANTVPTTIGSSDAIFVGMK LHVTLFLLLVASCAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10042612 [exp]	0	1
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10022066 [exp]	2.0	0.9766
AT5G13580		ABCG6	ATP-binding cassette G6, ABC-2...		Lus10030306 [exp]	2.8	0.9705
AT1G54540			Late embryogenesis abundant (L...		Lus10031888 [exp]	3.0	0.9685
AT2G16720	MYB	AtY49, AtMYB7	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10033473 [exp]	5.3	0.9470
AT2G37530			unknown protein		Lus10025320 [exp]	6.0	0.9002
AT1G62640		KAS III, KASIII	3-ketoacyl-acyl carrier protei...		Lus10032246 [exp]	6.8	0.8926
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10032554 [exp]	7.5	0.9565
AT1G05450			Bifunctional inhibitor/lipid-t...		Lus10041196 [exp]	8.8	0.9478
AT4G24130			Protein of unknown function, D...		Lus10017330 [exp]	9.7	0.9502
AT5G13580		ABCG6	ATP-binding cassette G6, ABC-2...		Lus10001972 [exp]	10.6	0.9454

Compare expression of checked genes

Lus10042612 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.