Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G48140 102 / 2e-28 EDA4 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G05450 90 / 1e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22620 62 / 5e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 47 / 6e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 46 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 42 / 4e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G64080 40 / 0.0002 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G70250 41 / 0.0003 receptor serine/threonine kinase, putative (.1) AT1G62790 39 / 0.0004 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G13820 38 / 0.0008 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022067 [exp] 206 / 1e-67 AT2G48140 122 / 2e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10014683 [exp] 127 / 8e-36 AT2G48140 145 / 6e-43 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10006906 [exp] 120 / 1e-35 AT2G48140 119 / 1e-35 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10010575 [exp] 106 / 6e-29 AT1G05450 142 / 2e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10021911 [exp] 75 / 7e-17 AT1G05450 121 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10041196 [exp] 75 / 8e-17 AT1G05450 122 / 5e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10010572 [exp] 41 / 0.0001 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 41 / 0.0001 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G212000 [exp] 117 / 2e-33 AT2G48140 113 / 4e-32 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G050200 [exp] 104 / 3e-28 AT2G48140 127 / 1e-37 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085200 [exp] 100 / 2e-26 AT1G05450 134 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G155200 [exp] 87 / 2e-21 AT2G48140 121 / 2e-34 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 40 / 0.0003 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 39 / 0.0005 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10042613 pacid=23181908 polypeptide=Lus10042613 locus=Lus10042613.g ID=Lus10042613.BGIv1.0 annot-version=v1.0 ATGGTGAGCAGCTTCACTCCTTGCATCAATTTCATCACCGGAAGCAGCGGCAACGGCACTACTTCGCCGGCCACCGGATGCTGTGATGCTCTGAAGGAAC TTGTCGCAGCCAGCATGGACTGCGCTTGTCTTGTCGTTACGGCCAATGTACCGATTCAGCTTCCCTTTGTTCCTCCTCTGTCCATCTCCCTCCCCAGGGC CTGCAAAATGGGAGTTCCCTTGCGCTGCAAAGCTTCTGTGTCTCCGCTGGCTGCGCCGGGGCCGGCTCTGTTACGGACTTCTACTGATGCACCTGCTCCT GCCCCACAATCAGCTTCAACCACAGTAGCAGTAGTAGACTCTCCGGCACCAGCTCCGGAATTAACGGCGACCCTGCCGAAAGAAGAAAACCCAACAACCA CCGTCGGACTAGGGCGACCTTTTGTGAACATCTCTGCTTCTGTTGTGTCGCACGACGTGCCACATTGTGTTGCTTCTCTGCTTTTCATAGCTGTGGCAAT CCTACTCGCCGCACATTGA
AA sequence Show only first row Show all	>Lus10042613 pacid=23181908 polypeptide=Lus10042613 locus=Lus10042613.g ID=Lus10042613.BGIv1.0 annot-version=v1.0 MVSSFTPCINFITGSSGNGTTSPATGCCDALKELVAASMDCACLVVTANVPIQLPFVPPLSISLPRACKMGVPLRCKASVSPLAAPGPALLRTSTDAPAP APQSASTTVAVVDSPAPAPELTATLPKEENPTTTVGLGRPFVNISASVVSHDVPHCVASLLFIAVAILLAAH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G48140		EDA4	embryo sac development arrest ...		Lus10042613 [exp]	0	1
					Lus10007414 [exp]	1.0	0.9796
AT4G30590		AtENODL12	early nodulin-like protein 12 ...		Lus10019955 [exp]	2.4	0.8093
AT2G22620			Rhamnogalacturonate lyase fami...		Lus10023106 [exp]	8.5	0.7337
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10021543 [exp]	11.1	0.7324
					Lus10017410 [exp]	12.1	0.6777
					Lus10000351 [exp]	12.4	0.7324
					Lus10002886 [exp]	13.6	0.7324
					Lus10014748 [exp]	14.7	0.7324
AT4G39700			Heavy metal transport/detoxifi...		Lus10019676 [exp]	14.9	0.6082
AT3G26880			Plant self-incompatibility pro...		Lus10022631 [exp]	15.7	0.7324

Compare expression of checked genes

Lus10042613 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.