Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52490 53 / 5e-10 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) AT4G29920 37 / 0.0003 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024536 [exp] 114 / 2e-35 AT3G52490 57 / 5e-11 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10009953 [exp] 99 / 3e-28 AT3G52490 68 / 1e-13 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10004526 [exp] 97 / 5e-26 AT3G52490 75 / 1e-14 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10021291 [exp] 92 / 1e-23 AT3G52490 690 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10016966 [exp] 92 / 2e-23 AT3G52490 606 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10022117 [exp] 62 / 3e-14 ND 39 / 1e-04 Lus10028849 [exp] 44 / 1e-06 AT3G52490 498 / 5e-165 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Lus10008970 [exp] 44 / 1e-06 AT3G52490 460 / 1e-147 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G017600 [exp] 48 / 5e-08 AT3G52490 635 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Potri.010G241600 [exp] 44 / 7e-07 AT3G52490 641 / 0.0 Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein (.1) Potri.018G140900 [exp] 40 / 3e-05 AT5G57130 751 / 0.0 Clp amino terminal domain-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042638 pacid=23181649 polypeptide=Lus10042638 locus=Lus10042638.g ID=Lus10042638.BGIv1.0 annot-version=v1.0 ATGGTGAGTTTGATTGAGAATTTAGTGAGCAATCAGTCGAGAAGCCGAGGGGTGGATATCGTGGGAGAGTGTCTTAGTACAGCTGAAGGCGTTCTGAAAG AAGTGATGGAAAAGGTCGAGAACGGTGAGGTACATGAGGTCCTGAGGGGAGCTAAGTTCGTATCCATTGTGTTTTGGGCAGCTTTGTACGATGGAGGAGG TTGA
AA sequence Show only first row Show all	>Lus10042638 pacid=23181649 polypeptide=Lus10042638 locus=Lus10042638.g ID=Lus10042638.BGIv1.0 annot-version=v1.0 MVSLIENLVSNQSRSRGVDIVGECLSTAEGVLKEVMEKVENGEVHEVLRGAKFVSIVFWAALYDGGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G52490			Double Clp-N motif-containing ...		Lus10042638 [exp]	0	1
AT1G31450			Eukaryotic aspartyl protease f...		Lus10002630 [exp]	1.0	0.9975
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10030286 [exp]	4.5	0.9658
AT2G28085			SAUR-like auxin-responsive pro...		Lus10041336 [exp]	4.5	0.7867
					Lus10033096 [exp]	5.5	0.9658
AT1G21270		WAK2	wall-associated kinase 2 (.1)		Lus10013385 [exp]	6.2	0.7880
AT1G27220			paired amphipathic helix repea...		Lus10000805 [exp]	6.3	0.9658
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10021338 [exp]	7.1	0.9658
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10010229 [exp]	7.7	0.9583
AT3G44150			unknown protein		Lus10021005 [exp]	8.4	0.9487
AT5G63920		TOP3A, AtTOP3al...	topoisomerase 3alpha (.1)		Lus10006779 [exp]	8.9	0.9451

Compare expression of checked genes

Lus10042638 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.