Lus10042643 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47200 91 / 1e-23 WPP2 WPP domain protein 2 (.1)
AT5G43070 87 / 3e-22 WPP1 WPP domain protein 1 (.1)
AT5G27940 57 / 9e-11 WPP3 WPP domain protein 3 (.1)
AT3G63130 41 / 0.0002 ATRANGAP1, RANGAP1 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009747 122 / 5e-36 AT1G47200 119 / 1e-34 WPP domain protein 2 (.1)
Lus10010235 107 / 4e-30 AT1G47200 124 / 2e-36 WPP domain protein 2 (.1)
Lus10006930 45 / 1e-05 AT3G63130 712 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Lus10014670 44 / 2e-05 AT3G63130 717 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G021900 107 / 8e-30 AT1G47200 115 / 1e-32 WPP domain protein 2 (.1)
Potri.002G122000 101 / 1e-27 AT1G47200 111 / 1e-31 WPP domain protein 2 (.1)
Potri.002G052900 49 / 3e-07 AT3G63130 664 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Potri.005G209600 47 / 2e-06 AT3G63130 667 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Potri.010G091100 43 / 4e-05 AT5G19320 646 / 0.0 RAN GTPase activating protein 2 (.1)
PFAM info
Representative CDS sequence
>Lus10042643 pacid=23181990 polypeptide=Lus10042643 locus=Lus10042643.g ID=Lus10042643.BGIv1.0 annot-version=v1.0
ATGTCCGACGCTGACACCGCTGCTGCCGCTCCCCCGCTAGAAAATCCAGCTAAGCAATCGGAGGAAAAGCCGTCAGCGCTGCCACAAGTCAGAAGCAGAA
TTGCTCTAAGCATTTGGCCTCCTTCGCAGCGCACCCGCGACGCTGTCATAGATCGCCTAATCGAGACCTTATCCACTCCCTCATTTCTCTCCAAGCGCTA
CGGGACAATTCCAGCGGAAGAGGCTGCCGACGCCGCTCGGCGTATCGAGGAGGAAGCCTTCGCTACTTCCACTGAATCTACTTCCGCCGATGACGACGGT
CTCGAGATACTCCAGCACTATTCCAAGGAGATCAGCAAGCGCATGCTGGGAACAGTAAAGGTTAGGGCCAGGTCGGATACCGCAGCGTCTGAAATTGCTC
CGTCCACGCCCCCGCTGGATGTTCCGTCACACCCTGCTTCTGCTAGTGAAGAAGTTTCGTCTTCTGTTGAGACTGAGGCATGA
AA sequence
>Lus10042643 pacid=23181990 polypeptide=Lus10042643 locus=Lus10042643.g ID=Lus10042643.BGIv1.0 annot-version=v1.0
MSDADTAAAAPPLENPAKQSEEKPSALPQVRSRIALSIWPPSQRTRDAVIDRLIETLSTPSFLSKRYGTIPAEEAADAARRIEEEAFATSTESTSADDDG
LEILQHYSKEISKRMLGTVKVRARSDTAASEIAPSTPPLDVPSHPASASEEVSSSVETEA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47200 WPP2 WPP domain protein 2 (.1) Lus10042643 0 1
AT5G67200 Leucine-rich repeat protein ki... Lus10041101 2.2 0.9326
AT5G37930 Protein with RING/U-box and TR... Lus10009111 4.6 0.8909
AT1G75080 BZR BZR1 BRASSINAZOLE-RESISTANT 1, Bras... Lus10026036 5.2 0.9229
AT5G45590 Ribosomal protein L35 (.1) Lus10010409 5.9 0.9097
AT2G14660 unknown protein Lus10033766 7.5 0.8992
AT5G48820 ICK6, KRP3 KIP-RELATED PROTEIN 3, inhibit... Lus10011862 8.4 0.9016
AT1G64450 Glycine-rich protein family (.... Lus10023071 10.5 0.8796
AT4G28100 unknown protein Lus10018524 10.8 0.8836
AT2G24440 selenium binding (.1) Lus10026958 11.5 0.9245
AT4G06599 ubiquitin family protein (.1) Lus10001294 11.5 0.8742

Lus10042643 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.