Lus10042653 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000488 62 / 3e-12 ND /
Lus10015596 56 / 3e-10 ND 41 / 2e-04
Lus10041342 56 / 1e-09 AT5G65005 44 / 6e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10002570 45 / 3e-06 ND /
Lus10032852 43 / 3e-05 AT3G09510 62 / 2e-10 Ribonuclease H-like superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10042653 pacid=23181795 polypeptide=Lus10042653 locus=Lus10042653.g ID=Lus10042653.BGIv1.0 annot-version=v1.0
ATGAAAAGCAATCAAGGGGGCCCTGAGATCCATGCTGATGATGAGTATTTCTGCTACGAGCAAGATCCTTGTATCATCGCGGGCTACGAAGTTGTTCTAT
TTACCTCTGGTGGGATTGTTTTTTATGGGAGGGCATGGTGTCTATTTTTTCAGGAGCCTTTGGTGGCGAAAGCTTGGCCCATACTAACGGTCGTTAGGCT
ATCTGTCACGCTGGTAGGCACGATCAATATGTTGTGGGATTGTAAGGTTCTTGTGATGGCTCTTAAGCAGCCGTCGGAGGGGTGGCCTTGGGCGTGTCTT
CAGCTTAACCCATCTATTCAGGTGTCCCATTGCCAAAGATCGAGACTTGTTTTGGTTGATCATATTGCCAGATTAGCGAGAGAAGGTAATGTAGCACCAG
GATGGGTAGCTGAATTGTAA
AA sequence
>Lus10042653 pacid=23181795 polypeptide=Lus10042653 locus=Lus10042653.g ID=Lus10042653.BGIv1.0 annot-version=v1.0
MKSNQGGPEIHADDEYFCYEQDPCIIAGYEVVLFTSGGIVFYGRAWCLFFQEPLVAKAWPILTVVRLSVTLVGTINMLWDCKVLVMALKQPSEGWPWACL
QLNPSIQVSHCQRSRLVLVDHIARLAREGNVAPGWVAEL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10042653 0 1
AT2G30900 TBL43 TRICHOME BIREFRINGENCE-LIKE 43... Lus10007367 4.6 0.9181
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10006244 8.0 0.9146
AT4G29035 Plant self-incompatibility pro... Lus10022825 8.8 0.9119
Lus10017869 9.8 0.9109
Lus10038154 10.4 0.9027
AT3G61680 alpha/beta-Hydrolases superfam... Lus10040915 11.5 0.8274
AT4G18770 MYB ATMYB98 myb domain protein 98 (.1) Lus10042111 12.7 0.9015
AT4G01550 NAC ANAC069, NTM2 NAC with Transmembrane Motif 2... Lus10010098 13.4 0.8017
AT1G09080 BIP3 binding protein 3, Heat shock ... Lus10013055 13.8 0.9098
Lus10042024 13.9 0.8991

Lus10042653 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.