Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02380 52 / 4e-10 SAG21, ATLEA5 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) AT1G02820 48 / 1e-08 Late embryogenesis abundant 3 (LEA3) family protein (.1) AT3G53770 42 / 6e-06 late embryogenesis abundant 3 (LEA3) family protein (.1), late embryogenesis abundant 3 (LEA3) family protein (.2) AT4G15910 40 / 2e-05 ATDI21 drought-induced 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029634 [exp] 141 / 1e-45 AT4G02380 57 / 4e-12 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10027986 [exp] 62 / 3e-14 AT1G02820 78 / 3e-20 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10008170 [exp] 62 / 6e-14 AT4G02380 83 / 3e-22 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10027987 [exp] 57 / 2e-12 AT1G02820 67 / 5e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10008169 [exp] 56 / 6e-12 AT1G02820 66 / 6e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G203500 [exp] 77 / 7e-20 AT4G02380 74 / 1e-18 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Potri.014G127700 [exp] 71 / 1e-17 AT4G02380 79 / 1e-20 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03242 [flax] [poplar] LEA_3 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10042672 pacid=23181783 polypeptide=Lus10042672 locus=Lus10042672.g ID=Lus10042672.BGIv1.0 annot-version=v1.0 ATGGCTCTCTCTTTCTCCAACGCTAAGATTCTTTCTGCTGCTCTGACCAAGACAATCAACGGCCGCAGAGGATTCTCCGCCGCCGCCGCTGCTGGGAAAG GCGGGATGGTGAAGAAAACTGGGGAAGACGTCTTGAACAAGAAGGTGTTCAAACCGATTCAAAGGGTTTCCTGGGTTCCTGACCCCCGAACCGGTTTCTA CAGACCCGAGAACGTCGCCGAGGATATTTACGACGCCGCTTACCAACGTGCTCTCCACTTGAAGAACTAA
AA sequence Show only first row Show all	>Lus10042672 pacid=23181783 polypeptide=Lus10042672 locus=Lus10042672.g ID=Lus10042672.BGIv1.0 annot-version=v1.0 MALSFSNAKILSAALTKTINGRRGFSAAAAAGKGGMVKKTGEDVLNKKVFKPIQRVSWVPDPRTGFYRPENVAEDIYDAAYQRALHLKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02380		SAG21, ATLEA5	Arabidopsis thaliana late embr...		Lus10042672 [exp]	0	1
AT4G19390			Uncharacterised protein family...		Lus10018793 [exp]	1.0	0.9039
					Lus10025700 [exp]	2.4	0.8777
AT3G52240			unknown protein		Lus10034158 [exp]	3.2	0.8666
AT5G48290			Heavy metal transport/detoxifi...		Lus10016062 [exp]	4.5	0.8902
					Lus10011661 [exp]	6.5	0.8655
AT5G55490		GEX1, ATGEX1	gamete expressed protein 1 (.1...		Lus10039900 [exp]	6.9	0.8313
AT4G24570		DIC2	dicarboxylate carrier 2 (.1)		Lus10015897 [exp]	9.4	0.8695
AT2G45080		CYCP3;1	cyclin p3;1 (.1)		Lus10028174 [exp]	9.8	0.8600
AT5G51990	AP2_ERF	CBF4, DREB1D	DEHYDRATION-RESPONSIVE ELEMENT...		Lus10019455 [exp]	11.0	0.8005
AT5G43260			chaperone protein dnaJ-related...		Lus10037022 [exp]	11.2	0.8557

Compare expression of checked genes

Lus10042672 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.