Lus10042684 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029619 233 / 2e-80 ND /
Lus10029617 211 / 2e-71 ND /
Lus10032788 207 / 5e-70 ND 36 / 0.007
Lus10032770 199 / 4e-67 ND /
Lus10003755 134 / 4e-41 ND 37 / 0.002
Lus10003753 129 / 1e-39 ND /
Lus10003754 127 / 9e-39 AT1G04520 39 / 3e-04 plasmodesmata-located protein 2 (.1)
Lus10029618 124 / 1e-37 ND /
Lus10008314 121 / 3e-36 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 37 / 0.0007 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10042684 pacid=23181673 polypeptide=Lus10042684 locus=Lus10042684.g ID=Lus10042684.BGIv1.0 annot-version=v1.0
ATGGCAGTAGCTGCAGCAGTACTTCTACTTCTGGGTATTTTGAGTGTCGTCGACTGTGCAGACAAGAGCGTCATCAACGGACCATACTGCGTTAAGAAAT
CTTTTGATAAAGATTACGACAAGAATGCAGCCCGTCTTATGGATATCCTTGTGGGCGAAACAAAGAACAAATACAGGACGGTGAATCATGAGGAATACAG
GTACTATCACAGCTACCCCAATACGGACTTGGGTTCCGTCCTTGGTGGGGGCTATTGCGATGGGCACCTGACGAAATGGGGATGCGGCAGTTGCCTTGGC
TCTGCGAGAGACAAAATCAAGTCCCGTTGCGATCGTACCTTTGAGGCTAGCATTACACTCGCTGACTGCTCCCTCTGGTTTAGGAAGATCGTCCCTTGA
AA sequence
>Lus10042684 pacid=23181673 polypeptide=Lus10042684 locus=Lus10042684.g ID=Lus10042684.BGIv1.0 annot-version=v1.0
MAVAAAVLLLLGILSVVDCADKSVINGPYCVKKSFDKDYDKNAARLMDILVGETKNKYRTVNHEEYRYYHSYPNTDLGSVLGGGYCDGHLTKWGCGSCLG
SARDKIKSRCDRTFEASITLADCSLWFRKIVP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10042684 0 1
AT4G30200 VEL1, VIL2 VIN3-Like 2, vernalization5/VI... Lus10004179 4.6 0.7960
AT5G41720 unknown protein Lus10011415 8.2 0.6501
Lus10012623 11.0 0.7453
AT1G47670 Transmembrane amino acid trans... Lus10003339 11.1 0.7753
Lus10026092 20.2 0.7484
AT1G10130 ATECA3, ECA3 ARABIDOPSIS THALIANA ER-TYPE C... Lus10018669 22.2 0.7689
AT1G61680 ATTPS14 terpene synthase 14 (.1.2) Lus10018392 26.1 0.7336
AT5G07050 nodulin MtN21 /EamA-like trans... Lus10026112 28.0 0.7303
AT5G49130 MATE efflux family protein (.1... Lus10009788 35.2 0.7292
AT3G51895 AST12, ATST1, S... sulfate transporter 3;1 (.1) Lus10039364 36.7 0.7350

Lus10042684 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.