Lus10042691 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G50260 320 / 6e-110 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
AT5G45890 318 / 4e-109 SAG12 senescence-associated gene 12 (.1)
AT3G48340 305 / 6e-104 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1)
AT4G35350 294 / 2e-99 XCP1 xylem cysteine peptidase 1 (.1.2)
AT1G20850 293 / 4e-99 XCP2 xylem cysteine peptidase 2 (.1)
AT3G19390 294 / 2e-98 Granulin repeat cysteine protease family protein (.1)
AT3G48350 291 / 4e-98 CEP3 cysteine endopeptidase 3, Cysteine proteinases superfamily protein (.1)
AT4G36880 285 / 6e-96 CP1 cysteine proteinase1 (.1)
AT5G43060 288 / 1e-95 Granulin repeat cysteine protease family protein (.1)
AT2G27420 280 / 3e-94 Cysteine proteinases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029649 491 / 3e-177 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1)
Lus10042693 479 / 1e-172 AT5G45890 379 / 1e-131 senescence-associated gene 12 (.1)
Lus10029658 476 / 2e-171 AT5G45890 383 / 4e-133 senescence-associated gene 12 (.1)
Lus10006542 367 / 2e-128 AT5G45890 391 / 2e-136 senescence-associated gene 12 (.1)
Lus10003275 363 / 8e-127 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10020722 362 / 2e-126 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Lus10026362 362 / 2e-126 AT5G45890 396 / 2e-138 senescence-associated gene 12 (.1)
Lus10042295 359 / 2e-125 AT5G45890 402 / 7e-141 senescence-associated gene 12 (.1)
Lus10026073 359 / 3e-125 AT5G45890 393 / 5e-137 senescence-associated gene 12 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G064900 367 / 2e-128 AT5G45890 401 / 3e-140 senescence-associated gene 12 (.1)
Potri.013G118200 355 / 2e-124 AT5G45890 387 / 2e-135 senescence-associated gene 12 (.1)
Potri.013G126100 354 / 2e-123 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1)
Potri.005G088600 347 / 2e-120 AT5G45890 406 / 8e-142 senescence-associated gene 12 (.1)
Potri.005G089100 346 / 3e-120 AT5G45890 405 / 1e-141 senescence-associated gene 12 (.1)
Potri.013G118400 346 / 3e-120 AT5G45890 378 / 2e-131 senescence-associated gene 12 (.1)
Potri.007G075300 345 / 9e-120 AT5G45890 406 / 6e-142 senescence-associated gene 12 (.1)
Potri.007G076100 343 / 7e-119 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1)
Potri.007G075900 343 / 7e-119 AT5G45890 411 / 7e-144 senescence-associated gene 12 (.1)
Potri.007G076000 342 / 8e-119 AT5G45890 407 / 2e-142 senescence-associated gene 12 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
Representative CDS sequence
>Lus10042691 pacid=23181732 polypeptide=Lus10042691 locus=Lus10042691.g ID=Lus10042691.BGIv1.0 annot-version=v1.0
ATGCCTGCCAAAACTGGATACAAGAAGACGGTCTCCGATCTCGGATCTTCGTTGTCATTCAAGTACCAGAATGTGAGCTCAGTGCCAGACACCATGGATT
GGAGAAATAAAGGAGCTGTTAATCCCATTAAAGATCAAGGCCAATGCGGATCCTGTTGGGCATTCTCTGCTGTGGCAGCAGTGGAAGGACTAATGAAGAT
CTCAACAGGGAAGTTGGTATCGCTTTCGGAGCAAGAACTGATCGACTGCGACAGAACGAGTAACGACCAAGGATGCAACGGAGGATTCATGGACGACGCT
TTTCAATACGTGAAGAGCAAAGGTCTCACAACCGAATCCAACTACCCTTACACGGCAGCAGATGGAACTTGCAACGCGGTCAAGACAAACCCTTCTTCGG
CCAAGATCAACGGTTACGAGGATGTACCTGCCAACGATGAGAAATCGTTGCTTAAAGCTGCGGCTAACCAGCCCATCTCTGTGGCCATTGATGCCAGTGG
CTCTGCTTTCCAGTTCTACTCGAGTGGAGTGTTCACCGGAGATTGTGGCACGGATTTGGATCATGGTGTGGCTGTCGTAGGGTATGGAACGAGTGGCGAT
GGTTCGAAGTACTGGCTGGTGAGGAACTCGTGGGGGACGAGCTGGGGAGATGGAGGGTACATCAAGATGCAGAGGGACGTTGGTGCTAAAGCAGGGCTCT
GTGGCATTGCTATGTCTGCTTCGTATCCCACTGCCTAA
AA sequence
>Lus10042691 pacid=23181732 polypeptide=Lus10042691 locus=Lus10042691.g ID=Lus10042691.BGIv1.0 annot-version=v1.0
MPAKTGYKKTVSDLGSSLSFKYQNVSSVPDTMDWRNKGAVNPIKDQGQCGSCWAFSAVAAVEGLMKISTGKLVSLSEQELIDCDRTSNDQGCNGGFMDDA
FQYVKSKGLTTESNYPYTAADGTCNAVKTNPSSAKINGYEDVPANDEKSLLKAAANQPISVAIDASGSAFQFYSSGVFTGDCGTDLDHGVAVVGYGTSGD
GSKYWLVRNSWGTSWGDGGYIKMQRDVGAKAGLCGIAMSASYPTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G50260 CEP1 cysteine endopeptidase 1, Cyst... Lus10042691 0 1
AT3G61150 HD HD-GL2-1, HDG1 HOMEODOMAIN-GLABRA2 1, homeodo... Lus10005758 1.4 0.7698
Lus10040835 3.3 0.7849
AT2G20710 Tetratricopeptide repeat (TPR)... Lus10029335 5.9 0.7231
AT5G45840 Leucine-rich repeat protein ki... Lus10007281 6.2 0.7692
AT4G35420 TKPR1, DRL1 tetraketide alpha-pyrone reduc... Lus10006141 7.5 0.7516
Lus10009381 14.1 0.7032
AT5G25910 AtRLP52 receptor like protein 52 (.1) Lus10016112 14.5 0.6692
AT5G37150 P-loop containing nucleoside t... Lus10035775 14.7 0.6130
AT1G70530 CRK3 cysteine-rich RLK (RECEPTOR-li... Lus10003274 15.6 0.6219
AT5G28740 Tetratricopeptide repeat (TPR)... Lus10003867 15.7 0.6120

Lus10042691 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.