Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G48150 187 / 2e-62 ATGPX4 glutathione peroxidase 4 (.1) AT3G63080 173 / 9e-57 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1) AT4G11600 155 / 1e-48 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1) AT2G25080 144 / 2e-44 ATGPX1 glutathione peroxidase 1 (.1) AT4G31870 143 / 4e-44 ATGPX7 glutathione peroxidase 7 (.1) AT2G31570 140 / 1e-43 ATGPX2 glutathione peroxidase 2 (.1) AT1G63460 134 / 2e-41 ATGPX8 glutathione peroxidase 8 (.1) AT2G43350 126 / 9e-38 ATGPX3 glutathione peroxidase 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029651 [exp] 215 / 3e-73 AT2G48150 274 / 2e-95 glutathione peroxidase 4 (.1) Lus10008537 [exp] 157 / 2e-50 AT4G11600 299 / 1e-104 glutathione peroxidase 6 (.1) Lus10008499 [exp] 158 / 8e-50 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1) Lus10008022 [exp] 154 / 3e-49 AT4G11600 301 / 1e-105 glutathione peroxidase 6 (.1) Lus10008023 [exp] 145 / 1e-44 AT1G63460 265 / 9e-91 glutathione peroxidase 8 (.1) Lus10026887 [exp] 143 / 8e-44 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1) Lus10042418 [exp] 142 / 2e-43 AT4G31870 329 / 2e-115 glutathione peroxidase 7 (.1) Lus10027021 [exp] 139 / 3e-43 AT2G31570 266 / 2e-92 glutathione peroxidase 2 (.1) Lus10003421 [exp] 143 / 7e-43 AT4G31870 319 / 9e-110 glutathione peroxidase 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G138800 [exp] 190 / 2e-63 AT2G48150 271 / 1e-94 glutathione peroxidase 4 (.1) Potri.003G126100 [exp] 160 / 7e-51 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1) Potri.001G105200 [exp] 151 / 4e-48 AT4G11600 298 / 3e-104 glutathione peroxidase 6 (.1) Potri.006G265400 [exp] 149 / 2e-46 AT2G25080 343 / 6e-121 glutathione peroxidase 1 (.1) Potri.001G105100 [exp] 142 / 2e-44 AT1G63460 283 / 5e-99 glutathione peroxidase 8 (.1) Potri.007G126600 [exp] 136 / 8e-42 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1) Potri.018G017500 [exp] 97 / 1e-26 AT2G25080 209 / 4e-69 glutathione peroxidase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00255 [flax] [poplar] GSHPx Glutathione peroxidase
Representative CDS sequence Show only first row Show all	>Lus10042692 pacid=23181815 polypeptide=Lus10042692 locus=Lus10042692.g ID=Lus10042692.BGIv1.0 annot-version=v1.0 ATGGGGGTTTCTGGGTCAGTACCGGAGAAATCAATCCACGAATTCGCCGTCAAGGATAGCAGAGGTAAGGATGTGGAGCTCAGCATCTACCAGGGGAAGG TTCTTCTCGTTGTTAACGTCGCTTCCAAATGCGGTTTCACTGATACAAATTACACCCAGTTGACTGATCTCTATCGCAAATACAAGGACCAAGGTTTTGA AATTCTGGCATTCCCTTGCAACCAATTCTTGAACCAGGAGCCTGGCACTAGTGAGGAGGCACAAGAGTTTGCTTGTACAAGATACAAGGCTGAGTATCCC ATTTTCCAAAAGACACACATCCAGAAAGAACTGGGAGACCAAGAATGA
AA sequence Show only first row Show all	>Lus10042692 pacid=23181815 polypeptide=Lus10042692 locus=Lus10042692.g ID=Lus10042692.BGIv1.0 annot-version=v1.0 MGVSGSVPEKSIHEFAVKDSRGKDVELSIYQGKVLLVVNVASKCGFTDTNYTQLTDLYRKYKDQGFEILAFPCNQFLNQEPGTSEEAQEFACTRYKAEYP IFQKTHIQKELGDQE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G48150		ATGPX4	glutathione peroxidase 4 (.1)		Lus10042692 [exp]	0	1
AT2G02950		PKS1	phytochrome kinase substrate 1...		Lus10023598 [exp]	1.4	0.9385
AT5G62360			Plant invertase/pectin methyle...		Lus10038915 [exp]	2.0	0.9162
AT5G05690		CBB3, DWF3, CYP...	DWARF 3, CYTOCHROME P450 90A1,...		Lus10014850 [exp]	5.5	0.9046
AT1G17200			Uncharacterised protein family...		Lus10042471 [exp]	8.7	0.9294
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Lus10023913 [exp]	9.0	0.9266
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10037473 [exp]	9.4	0.8606
AT5G57670			Protein kinase superfamily pro...		Lus10015516 [exp]	10.4	0.8512
					Lus10002266 [exp]	11.6	0.9161
AT5G42890		ATSCP2	sterol carrier protein 2 (.1)		Lus10021727 [exp]	14.8	0.8815
					Lus10006417 [exp]	14.9	0.9122

Compare expression of checked genes

Lus10042692 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.