Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G48200 82 / 2e-21 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G084400 [exp] 117 / 3e-35 AT1G48200 74 / 2e-18 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042704 pacid=23181777 polypeptide=Lus10042704 locus=Lus10042704.g ID=Lus10042704.BGIv1.0 annot-version=v1.0 ATGGAATCGGTGAACAGACTGCTATCGGCGGCGATGAAAGCCCCCGACAATAATACGGTGATAAACGTCTTCCTGGTTGGAGCCTTCGCGGCACTCGGCG TGCGGTCAATGAGCCAGCAGAAGAACATCGAAGCTATGGAGGCGGAGAAAGAGTCATTGGTCAATTCCAACAAATCCATGAAGAAATCGATGTGGGACTG GAAGCAGCAACTCTTCGCTGAAGCCTCTGCCGGCACTTCCGCGATCCCTCTCGCCAGACTCCAAGCCATCTACGGCTATTCCCCGGCGCCTCAGCAAACT GGTACGCTCTCTCTTTCTCTCCAGCCCCAAATTGCTAGGGTTTTCTTGTAA
AA sequence Show only first row Show all	>Lus10042704 pacid=23181777 polypeptide=Lus10042704 locus=Lus10042704.g ID=Lus10042704.BGIv1.0 annot-version=v1.0 MESVNRLLSAAMKAPDNNTVINVFLVGAFAALGVRSMSQQKNIEAMEAEKESLVNSNKSMKKSMWDWKQQLFAEASAGTSAIPLARLQAIYGYSPAPQQT GTLSLSLQPQIARVFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G48200			unknown protein		Lus10042704 [exp]	0	1
AT4G16450			unknown protein		Lus10038803 [exp]	9.6	0.7135
AT2G02510			NADH dehydrogenase (ubiquinone...		Lus10005182 [exp]	13.2	0.6805
AT1G73770			unknown protein		Lus10007968 [exp]	16.5	0.6010
AT4G05400			copper ion binding (.1.2)		Lus10027072 [exp]	16.7	0.6834
AT2G38130		ATMAK3	Acyl-CoA N-acyltransferases (N...		Lus10012579 [exp]	17.3	0.6599
AT5G49210			unknown protein		Lus10043148 [exp]	32.5	0.6214
AT5G44170			S-adenosyl-L-methionine-depend...		Lus10018640 [exp]	34.6	0.6457
AT5G62030			diphthamide synthesis DPH2 fam...		Lus10039108 [exp]	39.3	0.6448
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10032561 [exp]	47.1	0.6365
AT2G25720			unknown protein		Lus10042976 [exp]	50.4	0.6355

Compare expression of checked genes

Lus10042704 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.