Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17930 48 / 2e-07 Aminotransferase-like, plant mobile domain family protein (.1) AT2G25010 48 / 2e-07 Aminotransferase-like, plant mobile domain family protein (.1) AT1G48120 47 / 6e-07 hydrolases;protein serine/threonine phosphatases (.1) AT2G04865 44 / 4e-06 Aminotransferase-like, plant mobile domain family protein (.1) AT1G51538 44 / 7e-06 Aminotransferase-like, plant mobile domain family protein (.1) AT1G50770 43 / 1e-05 Aminotransferase-like, plant mobile domain family protein (.1) AT1G50820 41 / 4e-05 Aminotransferase-like, plant mobile domain family protein (.1) AT1G50790 40 / 0.0002 Plant mobile domain protein family (.1) AT4G16050 39 / 0.0005 Aminotransferase-like, plant mobile domain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004818 [exp] 145 / 1e-43 AT1G17930 56 / 2e-08 Aminotransferase-like, plant mobile domain family protein (.1) Lus10008761 [exp] 144 / 1e-42 AT2G25010 79 / 1e-15 Aminotransferase-like, plant mobile domain family protein (.1) Lus10012081 [exp] 128 / 4e-38 AT1G17930 53 / 8e-08 Aminotransferase-like, plant mobile domain family protein (.1) Lus10032693 [exp] 86 / 5e-23 AT2G25010 52 / 3e-09 Aminotransferase-like, plant mobile domain family protein (.1) Lus10027047 [exp] 90 / 4e-22 AT1G17930 119 / 1e-28 Aminotransferase-like, plant mobile domain family protein (.1) Lus10020970 [exp] 86 / 8e-21 AT1G17930 123 / 2e-30 Aminotransferase-like, plant mobile domain family protein (.1) Lus10003430 [exp] 69 / 1e-14 AT5G51100 60 / 6e-10 Fe superoxide dismutase 2 (.1) Lus10014633 [exp] 66 / 1e-14 AT2G04865 61 / 2e-11 Aminotransferase-like, plant mobile domain family protein (.1) Lus10010613 [exp] 57 / 4e-11 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10042711 pacid=23181947 polypeptide=Lus10042711 locus=Lus10042711.g ID=Lus10042711.BGIv1.0 annot-version=v1.0 ATGATGATGTATACCTCGGGACTTCTCCAGTTGGGTCGTTTTGGTATAATCGATATGTTGGACGAGGCTCTGATCCACGCTTTTGTTGAGAGGTGGCAGC CAGACACTAACACGTTTCCCATGCCATTTGAAGAGATGATCATCACACTTCATGATGTTTGGCATACTCTTCGTATCCCGGTACACGGACGTCCACTTCA CATTCTACGGTCCAGCGAGGAGTTGTTGGCCGATATAGTTAGGGTCCTCCGTATCCATCCTGGGGATTTGAAGTTTTCAGTTGGAGGCCCAGCAGGTACG GGATGCCTGATACCCTTGGCTGAAGGGTGCTGCGATGCATGA
AA sequence Show only first row Show all	>Lus10042711 pacid=23181947 polypeptide=Lus10042711 locus=Lus10042711.g ID=Lus10042711.BGIv1.0 annot-version=v1.0 MMMYTSGLLQLGRFGIIDMLDEALIHAFVERWQPDTNTFPMPFEEMIITLHDVWHTLRIPVHGRPLHILRSSEELLADIVRVLRIHPGDLKFSVGGPAGT GCLIPLAEGCCDA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G25010			Aminotransferase-like, plant m...		Lus10042711 [exp]	0	1

Compare expression of checked genes

Lus10042711 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.