Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24960 48 / 3e-07 unknown protein AT4G02210 40 / 0.0002 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004902 [exp] 77 / 2e-19 ND 36 / 0.002 Lus10007175 [exp] 73 / 5e-16 AT5G27260 67 / 2e-12 unknown protein Lus10022379 [exp] 70 / 7e-15 AT5G27260 74 / 1e-14 unknown protein Lus10004397 [exp] 67 / 5e-14 AT5G27260 77 / 6e-16 unknown protein Lus10022573 [exp] 59 / 3e-12 ND / Lus10018174 [exp] 57 / 2e-10 AT5G41980 68 / 1e-12 unknown protein Lus10034368 [exp] 57 / 2e-10 AT5G38900 147 / 2e-43 Thioredoxin superfamily protein (.1) Lus10037335 [exp] 57 / 3e-10 AT5G27260 69 / 7e-13 unknown protein Lus10010798 [exp] 56 / 4e-10 AT5G27260 61 / 5e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G172900 [exp] 42 / 4e-05 AT2G24960 96 / 1e-21 unknown protein Potri.006G265900 [exp] 42 / 6e-05 AT2G24960 761 / 0.0 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042715 pacid=23182033 polypeptide=Lus10042715 locus=Lus10042715.g ID=Lus10042715.BGIv1.0 annot-version=v1.0 ATGGGGAGGAGAAAGAAAACTGGAGTTAATGTTGGTGATGACAATACAATTCCTCGGGTTTACAATCAGTGGAATTCGAGACATGATGGTCCATTTTCGG AGTGCCTACTAGGGTTGACGGAGAAAGGACAAATCGAGGCGGGAGCTTGCAAGAATGGTGTATTCCTTGAGATAGAGGGTATGATGAACAACAAGGTGCA TGGTTGTGGTCTGAAAGCGAAGCCTGCAATTCAAAATAGATACAACAAACTGAAATATTGGTACCAAGCAACTGTCTTGATGCGCAGTCAGAGCGGCTTC GGTTGGGATGAAGAGAAGGTCTGCGTAGATGCATCCAAGGATGTTTGGGATCCGTGTGTTGAGAAACCAATGACTGCATAA
AA sequence Show only first row Show all	>Lus10042715 pacid=23182033 polypeptide=Lus10042715 locus=Lus10042715.g ID=Lus10042715.BGIv1.0 annot-version=v1.0 MGRRKKTGVNVGDDNTIPRVYNQWNSRHDGPFSECLLGLTEKGQIEAGACKNGVFLEIEGMMNNKVHGCGLKAKPAIQNRYNKLKYWYQATVLMRSQSGF GWDEEKVCVDASKDVWDPCVEKPMTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G24960			unknown protein		Lus10042715 [exp]	0	1
AT4G35220			Cyclase family protein (.1)		Lus10027872 [exp]	7.0	0.9623
AT5G16690		ORC3, ATORC3	origin recognition complex sub...		Lus10021778 [exp]	7.0	0.9290
					Lus10025268 [exp]	9.8	0.9619
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Lus10026232 [exp]	12.0	0.9619
AT5G25180		CYP71B14	"cytochrome P450, family 71, s...		Lus10033634 [exp]	13.1	0.8832
AT2G15220			Plant basic secretory protein ...		Lus10001608 [exp]	13.9	0.9619
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10005144 [exp]	15.5	0.9619
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10009630 [exp]	17.0	0.9619
					Lus10011605 [exp]	18.3	0.9619
					Lus10028570 [exp]	19.6	0.9619

Compare expression of checked genes

Lus10042715 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.