Lus10042727 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G63420 65 / 2e-14 AGG1, ATAGG1 Ggamma-subunit 1 (.1.2)
AT3G22942 59 / 3e-12 AtGG2, AGG2 G-protein gamma subunit 2 (.1)
AT5G18970 38 / 0.0008 AWPM-19-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029687 170 / 7e-55 AT3G63420 69 / 4e-16 Ggamma-subunit 1 (.1.2)
Lus10014714 63 / 2e-13 AT3G63420 104 / 2e-30 Ggamma-subunit 1 (.1.2)
Lus10003092 63 / 2e-13 AT3G63420 103 / 2e-30 Ggamma-subunit 1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G081500 102 / 7e-29 AT3G63420 62 / 1e-13 Ggamma-subunit 1 (.1.2)
Potri.005G179600 102 / 1e-28 AT3G63420 81 / 3e-21 Ggamma-subunit 1 (.1.2)
Potri.015G142500 72 / 6e-17 AT3G22942 100 / 4e-29 G-protein gamma subunit 2 (.1)
Potri.002G046900 58 / 1e-11 AT3G63420 102 / 1e-29 Ggamma-subunit 1 (.1.2)
Potri.005G216100 56 / 8e-11 AT3G63420 103 / 4e-30 Ggamma-subunit 1 (.1.2)
PFAM info
Representative CDS sequence
>Lus10042727 pacid=23181986 polypeptide=Lus10042727 locus=Lus10042727.g ID=Lus10042727.BGIv1.0 annot-version=v1.0
ATGGAGGATGGAAATAGCAGCGTGGTTGGTGATGACCAGCTCTTAGAAACCAGATCTTCATATGAAGAAGATCAAGTTCAACAACAACAACAGCAAGAGG
AAGAAGAAGAAGAAGAAGAAGAGTCAACAATTACTACTCGTACAGTGATGTCAAGGAGGAGCACCAATTCAATTTCTTCTTCTCCTCACCCTACAACTCC
TACTACTCCAACGACCAACAATGGCTACTTCGGCAAGCATCGGATGGCTGCTTCCCTCTCCATTCTTCAACTTCAAATCCAATCCACCCAGGAAGAACTG
GATCAGCTGGAAAGCATGGGCGGCTGCTCTGCTGTCTGCCCAGAATTGGTGACGAGTGTGGAATCCATCCCTGACCCTCTCCTCCCTTCGAGCAGAGGAC
CAACAAATGAAAACTGGGATCGCTGGTTTCGAGGAGCCCACCACAACACGCGTCGCAGGTGGATCTGA
AA sequence
>Lus10042727 pacid=23181986 polypeptide=Lus10042727 locus=Lus10042727.g ID=Lus10042727.BGIv1.0 annot-version=v1.0
MEDGNSSVVGDDQLLETRSSYEEDQVQQQQQQEEEEEEEEESTITTRTVMSRRSTNSISSSPHPTTPTTPTTNNGYFGKHRMAASLSILQLQIQSTQEEL
DQLESMGGCSAVCPELVTSVESIPDPLLPSSRGPTNENWDRWFRGAHHNTRRRWI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G63420 AGG1, ATAGG1 Ggamma-subunit 1 (.1.2) Lus10042727 0 1
AT3G62420 bZIP ATBZIP53 basic region/leucine zipper mo... Lus10025024 4.2 0.9215
AT5G04760 MYB Duplicated homeodomain-like su... Lus10036413 5.5 0.9224
AT3G61540 alpha/beta-Hydrolases superfam... Lus10001877 6.0 0.9155
AT2G16790 P-loop containing nucleoside t... Lus10037373 6.8 0.8804
AT4G21450 PapD-like superfamily protein ... Lus10002595 8.2 0.8969
AT3G62420 bZIP ATBZIP53 basic region/leucine zipper mo... Lus10010005 10.7 0.9198
AT1G26670 VTI1B, ATVTI12,... VESICAL TRANSPORT V-SNARE 12, ... Lus10037141 12.0 0.8993
AT1G54320 LEM3 (ligand-effect modulator ... Lus10001834 12.5 0.8904
AT3G26020 Protein phosphatase 2A regulat... Lus10036926 12.6 0.8879
AT5G45920 SGNH hydrolase-type esterase s... Lus10013941 14.1 0.9044

Lus10042727 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.