Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01720 414 / 5e-147 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G77450 311 / 6e-107 NAC ANAC032 NAC domain containing protein 32 (.1) AT5G63790 302 / 2e-102 NAC ANAC102 NAC domain containing protein 102 (.1) AT5G08790 293 / 2e-99 NAC ATAF2, ANAC081 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT3G15500 231 / 2e-74 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT1G52890 229 / 6e-74 NAC ANAC019 NAC domain containing protein 19 (.1) AT4G27410 228 / 2e-73 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT3G04070 227 / 1e-72 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G61110 225 / 4e-72 NAC ANAC025 NAC domain containing protein 25 (.1) AT1G69490 219 / 2e-70 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029692 [exp] 444 / 6e-159 AT1G01720 268 / 9e-90 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10025690 [exp] 443 / 3e-158 AT1G01720 405 / 1e-143 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10018142 [exp] 440 / 7e-157 AT1G01720 401 / 7e-142 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10020883 [exp] 300 / 9e-102 AT5G08790 320 / 6e-110 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10033493 [exp] 296 / 3e-100 AT5G08790 315 / 4e-108 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10043095 [exp] 235 / 2e-75 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10032657 [exp] 233 / 2e-74 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10011215 [exp] 228 / 5e-73 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1) Lus10003269 [exp] 229 / 6e-73 AT3G04070 324 / 3e-109 NAC domain containing protein 47 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G081000 [exp] 413 / 1e-146 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G180200 [exp] 384 / 4e-135 AT1G01720 392 / 9e-139 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G069500 [exp] 361 / 9e-126 AT1G01720 357 / 3e-124 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.007G099400 [exp] 360 / 2e-125 AT1G01720 366 / 6e-128 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.001G404100 [exp] 239 / 3e-77 AT4G27410 370 / 8e-129 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.011G123300 [exp] 238 / 4e-77 AT4G27410 354 / 2e-122 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.001G404400 [exp] 231 / 7e-74 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.011G046700 [exp] 230 / 9e-74 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.004G038000 [exp] 230 / 1e-73 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.011G123500 [exp] 229 / 1e-73 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10042731 pacid=23181865 polypeptide=Lus10042731 locus=Lus10042731.g ID=Lus10042731.BGIv1.0 annot-version=v1.0 ATGGTGTTGGAGTTGCCTCCGGGATTCAGGTTCCATCCCACCGACGACGAGCTCGTCAAGCACTACCTCTGCCGGAAGTGCGCCTCCCAACCGATTTCCG TCCCGATTATTGCCGAAATCGATTTGTATAAGCACGATCCGTGGGATCTCCCAGGTTTGGCTTTGTATGGAGAAAAGGAGTGGTACTTCTTTTCACCGAG AGACCGGAAGTATCCGAACGGATCCCGGCCTAATCGATCCGCAGCTACCGGTTATTGGAAGGCTACCGGAGCTGACAAGTCAATTGGATCTCCGAGACCA ATCGCAATCAAGAAAGCGTTGGTGTTTTACACTGGGAAAGCTCCCAAGGGTGAGAAAACCAACTGGATTATGCACGAATACCGGCTCGCTGATGTGGATC GATCTGCCGCGAGGAAGAAGAACAGCTTAAGGCTTGACGATTGGGTGCTGTGTCGGATTTACAACAAGAAGGGCGCCGCTGTTGATAGGCGGACTGCAGG GATCCGAAGAGCTGTTTCGCCGGAGACGATGGAGGACATTAAACCGTCGGTGATGGCACCTCCGCCTCCTCAATTGCCGACCGGAGGTCATCAGACTAAC CCGGCCAACAGCGGACATACGTACTTGGAGACGTCAGAATCGGTGCCGAGGCTTCTTACGGACTCGAGCTGCTCGGAGCAGGTTTTCTCGCCGGAGTTCA CCACGAGCGAGGTGCAGAGCGAGCCAAAATGGAAGGAGTTGGGGGCGGGGATGAATGACCTTGACTTTGGGTTTAATTACATGGATGCCACCATGGAGAA GGAGTTCGGTTCGCAATTCCAGTTCCCCGGTAGTAGTAATCAGATGTCGCCGTTGCAGGATATGTTCATGTACCTGCAGCAACCATTTTGA
AA sequence Show only first row Show all	>Lus10042731 pacid=23181865 polypeptide=Lus10042731 locus=Lus10042731.g ID=Lus10042731.BGIv1.0 annot-version=v1.0 MVLELPPGFRFHPTDDELVKHYLCRKCASQPISVPIIAEIDLYKHDPWDLPGLALYGEKEWYFFSPRDRKYPNGSRPNRSAATGYWKATGADKSIGSPRP IAIKKALVFYTGKAPKGEKTNWIMHEYRLADVDRSAARKKNSLRLDDWVLCRIYNKKGAAVDRRTAGIRRAVSPETMEDIKPSVMAPPPPQLPTGGHQTN PANSGHTYLETSESVPRLLTDSSCSEQVFSPEFTTSEVQSEPKWKELGAGMNDLDFGFNYMDATMEKEFGSQFQFPGSSNQMSPLQDMFMYLQQPF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01720	NAC	ATAF1, ANAC002	Arabidopsis NAC domain contain...		Lus10042731 [exp]	0	1
AT1G10740			alpha/beta-Hydrolases superfam...		Lus10029114 [exp]	1.0	0.8619
					Lus10008536 [exp]	2.4	0.8244
AT4G37710			VQ motif-containing protein (....		Lus10019270 [exp]	4.5	0.7892
AT1G33590			Leucine-rich repeat (LRR) fami...		Lus10002936 [exp]	4.9	0.8543
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10014110 [exp]	12.6	0.7249
AT2G41480			Peroxidase superfamily protein...		Lus10020421 [exp]	15.4	0.8030
AT4G10955			alpha/beta-Hydrolases superfam...		Lus10023072 [exp]	19.1	0.7328
AT5G51630			Disease resistance protein (TI...		Lus10012028 [exp]	24.5	0.7390
AT5G23190		CYP86B1	"cytochrome P450, family 86, s...		Lus10040986 [exp]	31.2	0.7164
AT2G40600			appr-1-p processing enzyme fam...		Lus10034226 [exp]	31.7	0.7798

Compare expression of checked genes

Lus10042731 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.