Lus10042733 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021769 81 / 2e-19 AT4G33300 583 / 0.0 ADR1-like 1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G129300 54 / 7e-10 AT4G33300 902 / 0.0 ADR1-like 1 (.1.2)
Potri.014G035700 50 / 1e-08 AT4G33300 889 / 0.0 ADR1-like 1 (.1.2)
PFAM info
Representative CDS sequence
>Lus10042733 pacid=23181888 polypeptide=Lus10042733 locus=Lus10042733.g ID=Lus10042733.BGIv1.0 annot-version=v1.0
ATGAAGATTGGTATTGGCGCAGCGGCAAGAGGAGGATGGGTGCACGAGGCAGTGAAGAGAGTGAATATGGAGGAGCAGCAGTGGGAGGGTAATTTACTGA
ATGCGTTGGGGGTTGGGATGGCGGAAGGGAAGAAGATAGTGAAGGAGATGGTGATTGAGAGGGATGCATTAGGGATTGTTGGAATTTTCGGGATTGGAGG
CTCTGGGAAGACTACTCTTGCTACTGATGTTCTGTAG
AA sequence
>Lus10042733 pacid=23181888 polypeptide=Lus10042733 locus=Lus10042733.g ID=Lus10042733.BGIv1.0 annot-version=v1.0
MKIGIGAAARGGWVHEAVKRVNMEEQQWEGNLLNALGVGMAEGKKIVKEMVIERDALGIVGIFGIGGSGKTTLATDVL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10042733 0 1
AT1G07210 Ribosomal protein S18 (.1) Lus10039100 3.9 0.6772
AT2G21240 BBR_BPC BPC4, BBR/BPC4,... basic pentacysteine 4 (.1.2) Lus10035462 4.9 0.6816
AT2G25830 YebC-related (.1) Lus10038722 17.3 0.6593
AT5G20990 B73, CNX1, SIR4... SIRTINOL 4, CO-FACTOR FOR NITR... Lus10000717 17.7 0.6874
AT1G29670 GDSL-like Lipase/Acylhydrolase... Lus10012000 19.5 0.6474
AT2G22870 EMB2001 embryo defective 2001, P-loop ... Lus10011703 21.7 0.6662
AT4G39470 Tetratricopeptide repeat (TPR)... Lus10035707 29.3 0.6449
AT5G40410 Tetratricopeptide repeat (TPR)... Lus10005638 34.0 0.6183
AT1G15940 Tudor/PWWP/MBT superfamily pro... Lus10009948 37.7 0.6619
AT3G52270 Transcription initiation facto... Lus10040384 42.2 0.6229

Lus10042733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.