Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G17085 85 / 4e-24 Putative membrane lipoprotein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029696 [exp] 117 / 9e-37 AT4G17085 87 / 9e-25 Putative membrane lipoprotein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G085400 [exp] 72 / 1e-18 AT4G17085 69 / 2e-17 Putative membrane lipoprotein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042735 pacid=23181706 polypeptide=Lus10042735 locus=Lus10042735.g ID=Lus10042735.BGIv1.0 annot-version=v1.0 ATGGGGAAATCCTTCACTTTGTTTCAAACTGTAGCCACAGCAGGAATCTTCTCTGCTGTTTCCGGCTGGTACGGTTTCATGTTCGGAAGAGAATCAGCTC GCAAAGAACTCGGCACCTTGATCGACGATCTTCGCCGCGGCGGAGATTCCGCCTCCCCTCCTCCTCAGCATTCTTGA
AA sequence Show only first row Show all	>Lus10042735 pacid=23181706 polypeptide=Lus10042735 locus=Lus10042735.g ID=Lus10042735.BGIv1.0 annot-version=v1.0 MGKSFTLFQTVATAGIFSAVSGWYGFMFGRESARKELGTLIDDLRRGGDSASPPPQHS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G17085			Putative membrane lipoprotein ...		Lus10042735 [exp]	0	1
AT4G17760			damaged DNA binding;exodeoxyri...		Lus10035367 [exp]	6.2	0.7826
AT5G08630			DDT domain-containing protein ...		Lus10029550 [exp]	8.1	0.7834
AT4G15950		RDM2, NRPE4, NR...	RNA-DIRECTED DNA METHYLATION 2...		Lus10038766 [exp]	12.9	0.7888
AT5G02530			RNA-binding (RRM/RBD/RNP motif...		Lus10040851 [exp]	14.7	0.7786
AT2G24970			unknown protein		Lus10026900 [exp]	15.7	0.7540
AT5G09250		KIWI	ssDNA-binding transcriptional ...		Lus10039207 [exp]	25.5	0.7075
AT1G07950		MED22B	Surfeit locus protein 5 subuni...		Lus10023466 [exp]	27.5	0.7468
AT3G09860			unknown protein		Lus10001400 [exp]	27.7	0.7597
AT1G62700	NAC	ANAC026, VND5	VASCULAR RELATED NAC-DOMAIN PR...		Lus10004338 [exp]	37.8	0.6809
AT4G30220		RUXF	small nuclear ribonucleoprotei...		Lus10037606 [exp]	38.7	0.7422

Compare expression of checked genes

Lus10042735 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.