Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77380 50 / 3e-09 AAP3, ATAAP3 amino acid permease 3 (.1) AT1G44100 49 / 1e-08 AAP5 amino acid permease 5 (.1) AT5G09220 46 / 1e-07 AAP2 amino acid permease 2 (.1) AT5G63850 39 / 4e-05 AAP4 amino acid permease 4 (.1) AT5G49630 36 / 0.0004 AAP6 amino acid permease 6 (.1) AT1G10010 36 / 0.0004 AAP8, ATAAP8 amino acid permease 8 (.1) AT1G58360 35 / 0.0006 NAT2, AAP1 NEUTRAL AMINO ACID TRANSPORTER 2, amino acid permease 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029703 [exp] 77 / 2e-18 AT1G44100 688 / 0.0 amino acid permease 5 (.1) Lus10028546 [exp] 56 / 5e-11 AT1G77380 552 / 0.0 amino acid permease 3 (.1) Lus10029702 [exp] 56 / 6e-11 AT1G77380 706 / 0.0 amino acid permease 3 (.1) Lus10018852 [exp] 54 / 2e-10 AT1G77380 702 / 0.0 amino acid permease 3 (.1) Lus10042740 [exp] 54 / 2e-10 AT1G77380 698 / 0.0 amino acid permease 3 (.1) Lus10029707 [exp] 54 / 3e-10 AT1G77380 759 / 0.0 amino acid permease 3 (.1) Lus10042744 [exp] 54 / 3e-10 AT1G77380 667 / 0.0 amino acid permease 3 (.1) Lus10037150 [exp] 52 / 1e-09 AT1G77380 680 / 0.0 amino acid permease 3 (.1) Lus10036777 [exp] 50 / 5e-09 AT1G77380 684 / 0.0 amino acid permease 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G079700 [exp] 52 / 7e-10 AT1G77380 756 / 0.0 amino acid permease 3 (.1) Potri.007G100100 [exp] 52 / 1e-09 AT5G09220 768 / 0.0 amino acid permease 2 (.1) Potri.005G181500 [exp] 50 / 3e-09 AT1G77380 728 / 0.0 amino acid permease 3 (.1) Potri.005G068900 [exp] 50 / 4e-09 AT5G09220 799 / 0.0 amino acid permease 2 (.1) Potri.009G133600 [exp] 49 / 9e-09 AT5G09220 711 / 0.0 amino acid permease 2 (.1) Potri.002G080066 [exp] 49 / 1e-08 AT1G77380 751 / 0.0 amino acid permease 3 (.1) Potri.002G079500 [exp] 49 / 1e-08 AT1G77380 766 / 0.0 amino acid permease 3 (.1) Potri.002G079400 [exp] 44 / 7e-07 AT1G77380 765 / 0.0 amino acid permease 3 (.1) Potri.005G181600 [exp] 44 / 8e-07 AT1G77380 746 / 0.0 amino acid permease 3 (.1) Potri.002G112100 [exp] 39 / 4e-05 AT5G49630 691 / 0.0 amino acid permease 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042742 pacid=23181832 polypeptide=Lus10042742 locus=Lus10042742.g ID=Lus10042742.BGIv1.0 annot-version=v1.0 ATGTACATTGCGGCGAACAGGATTCCGAAGTGGAGCACGAGGTGGGTTGGATTGGAGATTCTGAGTATGGTTTGCTTGGTTGTTGCGATTGCTGCTGCTG TTGGGTCTATTGTTGGGGTGATTGGTGATTTGAAGTCTGTGAAACCGTTCCATGCCGTTTTCTGA
AA sequence Show only first row Show all	>Lus10042742 pacid=23181832 polypeptide=Lus10042742 locus=Lus10042742.g ID=Lus10042742.BGIv1.0 annot-version=v1.0 MYIAANRIPKWSTRWVGLEILSMVCLVVAIAAAVGSIVGVIGDLKSVKPFHAVF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G44100		AAP5	amino acid permease 5 (.1)		Lus10042742 [exp]	0	1
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10031172 [exp]	1.4	0.9038
					Lus10003927 [exp]	5.1	0.8490
AT4G27570			UDP-Glycosyltransferase superf...		Lus10013367 [exp]	5.2	0.9054
					Lus10038177 [exp]	6.2	0.7936
					Lus10029261 [exp]	9.2	0.9032
AT5G10050			NAD(P)-binding Rossmann-fold s...		Lus10019683 [exp]	9.4	0.7711
AT5G56990			unknown protein		Lus10029528 [exp]	10.6	0.9032
					Lus10003825 [exp]	11.8	0.9032
					Lus10021285 [exp]	13.0	0.7440
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10014062 [exp]	13.0	0.9032

Compare expression of checked genes

Lus10042742 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.