Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16990 145 / 5e-41 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative AT5G46450 143 / 5e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G16950 141 / 2e-39 RPP5 RECOGNITION OF PERONOSPORA PARASITICA 5, Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G41750 141 / 2e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72930 129 / 9e-39 TIR toll/interleukin-1 receptor-like (.1.2) AT5G51630 139 / 1e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT4G16860 137 / 4e-38 RPP5, RPP4 recognition of peronospora parasitica 4, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G12010 136 / 1e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G46510 135 / 2e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT2G20142 130 / 2e-37 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029722 [exp] 265 / 3e-83 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10013729 [exp] 150 / 4e-43 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011104 [exp] 151 / 7e-43 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10014829 [exp] 141 / 3e-39 AT5G17680 441 / 1e-136 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10026201 [exp] 140 / 5e-39 AT5G17680 511 / 1e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10005588 [exp] 140 / 5e-39 AT5G17680 499 / 2e-156 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10014582 [exp] 134 / 6e-39 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10041060 [exp] 139 / 8e-39 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10018616 [exp] 135 / 2e-37 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G069866 [exp] 176 / 1e-56 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G070436 [exp] 174 / 2e-56 AT2G20142 160 / 7e-49 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G068200 [exp] 184 / 2e-54 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G069500 [exp] 183 / 5e-54 AT5G17680 711 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070700 [exp] 182 / 1e-53 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070651 [exp] 182 / 1e-53 AT5G17680 630 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G069600 [exp] 181 / 2e-53 AT5G17680 647 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G069733 [exp] 169 / 4e-53 AT2G20142 147 / 1e-42 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G070393 [exp] 180 / 5e-53 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.013G096849 [exp] 165 / 1e-52 AT5G36930 167 / 4e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10042752 pacid=23181974 polypeptide=Lus10042752 locus=Lus10042752.g ID=Lus10042752.BGIv1.0 annot-version=v1.0 ATGTCTTCTTCTTCTTTGGTTTCCGTTTCTCCTGGATTCAAGTACGATGTGTTCCTCGGTTTCTGTGGTAAGGACACCCGCGACAGCTTCACGAGCCATC TCCACGCTGCTCTGCTTCAGAAACAGATCAACACTTTCATCGATGACCAACTCACCAGAGGCCAGGAAATTTCCCCTGCCATCTTGAAAGCGATCGAAAA ATCCATGATTTCCATCGTCATCTTCTCCCCACACTATGCAGCTTCCAGTTGGTGCTTGGAGGAGTTGGTAAAGATTCTGGAATGCAAGAAAGCAATGGGC TCCATGGTTCTGCCTGTTTTCTACTCCGTCGATCCTTCCCACGTAACTGAACAATCAGGAAGCTTCGGGGAGGAGTTTCGACTCTCGGTGGAGAAGGAGA GTACGAACAAGGTCAAGGTCCATAGATGGAAAGCTGCTTTGTCTGAAGCTGCCAATTTGTCCGGCTCGTTGACCTGA
AA sequence Show only first row Show all	>Lus10042752 pacid=23181974 polypeptide=Lus10042752 locus=Lus10042752.g ID=Lus10042752.BGIv1.0 annot-version=v1.0 MSSSSLVSVSPGFKYDVFLGFCGKDTRDSFTSHLHAALLQKQINTFIDDQLTRGQEISPAILKAIEKSMISIVIFSPHYAASSWCLEELVKILECKKAMG SMVLPVFYSVDPSHVTEQSGSFGEEFRLSVEKESTNKVKVHRWKAALSEAANLSGSLT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16990		RLM3	RESISTANCE TO LEPTOSPHAERIA MA...		Lus10042752 [exp]	0	1
AT4G12010			Disease resistance protein (TI...		Lus10042753 [exp]	2.0	0.8595
AT3G13080		EST2, ATMRP3, A...	MULTIDRUG RESISTANCE PROTEIN 3...		Lus10030718 [exp]	8.9	0.7303
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10012870 [exp]	11.9	0.7986
AT3G57120			Protein kinase superfamily pro...		Lus10027054 [exp]	13.8	0.8132
AT1G75170			Sec14p-like phosphatidylinosit...		Lus10025128 [exp]	14.8	0.7817
AT4G25800			Calmodulin-binding protein (.1...		Lus10029861 [exp]	15.1	0.7701
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10034244 [exp]	21.5	0.7851
AT2G30630			P-loop containing nucleoside t...		Lus10021884 [exp]	22.1	0.7540
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10030517 [exp]	22.6	0.7636
AT5G05190			Protein of unknown function (D...		Lus10029013 [exp]	22.9	0.7426

Compare expression of checked genes

Lus10042752 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.