Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G21090 177 / 4e-56 Leucine-rich repeat (LRR) family protein (.1) AT3G43740 174 / 5e-55 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) AT4G33430 160 / 7e-46 SERK3, RKS10, ELG, BAK1, ATSERK3, ATBAK1 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) AT1G34210 158 / 4e-45 ATSERK2, SERK2 somatic embryogenesis receptor-like kinase 2 (.1) AT1G71830 155 / 4e-44 ATSERK1, SERK1 somatic embryogenesis receptor-like kinase 1 (.1) AT2G13790 150 / 3e-42 BAK7, BKK1, ATSERK4 BAK1-LIKE 1, BRI1- ASSOCIATED KINASE 7, somatic embryogenesis receptor-like kinase 4 (.1) AT2G13800 133 / 4e-36 BAK8, ATSERK5 BRI1- ASSOCIATED KINASE 8, SOMATIC EMBRYOGENESIS RECEPTOR LIKE KINASE 5, somatic embryogenesis receptor-like kinase 5 (.1) AT5G16000 112 / 2e-28 NIK1 NSP-interacting kinase 1 (.1) AT3G25560 107 / 5e-27 NIK2 NSP-interacting kinase 2 (.1.2.3) AT5G10290 104 / 5e-26 leucine-rich repeat transmembrane protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002579 [exp] 168 / 1e-52 AT5G21090 275 / 3e-94 Leucine-rich repeat (LRR) family protein (.1) Lus10026751 [exp] 166 / 2e-52 AT5G21090 250 / 2e-85 Leucine-rich repeat (LRR) family protein (.1) Lus10002117 [exp] 167 / 4e-52 AT3G43740 273 / 9e-94 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Lus10004958 [exp] 162 / 3e-50 AT1G34210 215 / 2e-66 somatic embryogenesis receptor-like kinase 2 (.1) Lus10001807 [exp] 158 / 9e-49 AT5G21090 227 / 9e-76 Leucine-rich repeat (LRR) family protein (.1) Lus10020962 [exp] 164 / 3e-47 AT4G33430 989 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) Lus10013902 [exp] 164 / 2e-46 AT1G49870 454 / 2e-145 unknown protein Lus10028716 [exp] 154 / 7e-44 AT1G71830 1000 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1) Lus10034413 [exp] 116 / 5e-30 AT5G16000 937 / 0.0 NSP-interacting kinase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G018800 [exp] 177 / 5e-56 AT5G21090 354 / 6e-126 Leucine-rich repeat (LRR) family protein (.1) Potri.001G219500 [exp] 174 / 4e-55 AT5G21090 348 / 2e-123 Leucine-rich repeat (LRR) family protein (.1) Potri.001G296500 [exp] 172 / 2e-54 AT3G43740 278 / 1e-95 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Potri.009G090700 [exp] 169 / 6e-53 AT3G43740 270 / 2e-92 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Potri.003G166200 [exp] 167 / 2e-52 AT5G21090 275 / 2e-94 Leucine-rich repeat (LRR) family protein (.1) Potri.001G061600 [exp] 167 / 3e-52 AT5G21090 272 / 2e-93 Leucine-rich repeat (LRR) family protein (.1) Potri.001G206700 [exp] 162 / 8e-47 AT4G33430 927 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) Potri.007G082400 [exp] 162 / 2e-46 AT1G34210 954 / 0.0 somatic embryogenesis receptor-like kinase 2 (.1) Potri.005G083300 [exp] 161 / 2e-46 AT1G71830 981 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1) Potri.003G023000 [exp] 161 / 2e-46 AT4G33430 961 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat CL0022 [flax] [poplar] PF08263 [flax] [poplar] LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10042755 pacid=23181867 polypeptide=Lus10042755 locus=Lus10042755.g ID=Lus10042755.BGIv1.0 annot-version=v1.0 ATGGAAGCACCAGGGTCAAGATCAGTACTTGGGGTACTGTTAGTTTCAGCAGTAGCATTGATGTTCCTAGTCGATGGAGCGCGGAGCAACGCAGAATCAG ACGTTTTGACAACTCTGAGAAGCAGTCTGTCGGATCCACAGCAGGTTCTTGACAGCTGGGATCCAACCTTAGCCGATCCTTGCACTTGGTTTCACGTCAC TTGCAACTCCGATGATCGCGTCACACGACTGGACTTGCGGCAGGACGGTTTGTCGGGACAATTAGTACCTGGAGTTGGTTCACTGGATCAACTTGAATAT TTGGTGCTGGCAGGAAACAGCTTAAACGGCAGCATTCCAGCAGAGCTTGGCAACTTGAAGAACCTTGTGGTTATGGATCTGTACGAGAACTCACTTACAG GCTCTATTCCCTCATCTTTCAGCAGCAACTTACAGTCTCTTCGATTCCTACGACTGCAGAACAATAAACTAAGTGGCAAAGTTCCAATTGAACTTGCGAG CATTCCTAATCTCAGGATCTTGAACATTTCGAACAATAACTTATGCGGAATTGTTCCTATTGAACTTTTACGTATCGAATTTCTCGATATCAGTAATAAT CCTGGTCTGGGAAGTCCTTGCCCATGA
AA sequence Show only first row Show all	>Lus10042755 pacid=23181867 polypeptide=Lus10042755 locus=Lus10042755.g ID=Lus10042755.BGIv1.0 annot-version=v1.0 MEAPGSRSVLGVLLVSAVALMFLVDGARSNAESDVLTTLRSSLSDPQQVLDSWDPTLADPCTWFHVTCNSDDRVTRLDLRQDGLSGQLVPGVGSLDQLEY LVLAGNSLNGSIPAELGNLKNLVVMDLYENSLTGSIPSSFSSNLQSLRFLRLQNNKLSGKVPIELASIPNLRILNISNNNLCGIVPIELLRIEFLDISNN PGLGSPCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G21090			Leucine-rich repeat (LRR) fami...		Lus10042755 [exp]	0	1
AT5G52790			CBS domain-containing protein ...		Lus10036040 [exp]	1.4	0.8494
AT5G66780			unknown protein		Lus10041741 [exp]	2.4	0.7977
AT1G70530		CRK3	cysteine-rich RLK (RECEPTOR-li...		Lus10003274 [exp]	2.8	0.7791
					Lus10040835 [exp]	4.0	0.8126
AT5G19360		CPK34	calcium-dependent protein kina...		Lus10036050 [exp]	4.5	0.7217
AT4G16160		ATOEP16-2, ATOE...	Mitochondrial import inner mem...		Lus10037743 [exp]	6.6	0.7216
AT1G02010		SEC1A	secretory 1A (.1.2)		Lus10009293 [exp]	10.5	0.6654
					Lus10041400 [exp]	14.0	0.7621
AT5G54740		SESA5	seed storage albumin 5 (.1)		Lus10023525 [exp]	18.2	0.7607
AT3G28480			Oxoglutarate/iron-dependent ox...		Lus10032184 [exp]	19.0	0.6968

Compare expression of checked genes

Lus10042755 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.