Lus10042759 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G37925 207 / 4e-69 NdhM, NDH-M NADH dehydrogenase-like complex M, subunit NDH-M of NAD(P)H:plastoquinone dehydrogenase complex (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029728 274 / 1e-95 AT4G37925 244 / 1e-82 NADH dehydrogenase-like complex M, subunit NDH-M of NAD(P)H:plastoquinone dehydrogenase complex (.1)
Lus10029727 171 / 2e-55 AT4G37925 172 / 6e-55 NADH dehydrogenase-like complex M, subunit NDH-M of NAD(P)H:plastoquinone dehydrogenase complex (.1)
Lus10042758 168 / 5e-53 AT4G37925 173 / 1e-53 NADH dehydrogenase-like complex M, subunit NDH-M of NAD(P)H:plastoquinone dehydrogenase complex (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G183000 220 / 1e-74 AT4G37925 244 / 2e-82 NADH dehydrogenase-like complex M, subunit NDH-M of NAD(P)H:plastoquinone dehydrogenase complex (.1)
Potri.002G077600 161 / 2e-51 AT4G37925 198 / 1e-64 NADH dehydrogenase-like complex M, subunit NDH-M of NAD(P)H:plastoquinone dehydrogenase complex (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10664 NdhM Cyanobacterial and plastid NDH-1 subunit M
Representative CDS sequence
>Lus10042759 pacid=23181775 polypeptide=Lus10042759 locus=Lus10042759.g ID=Lus10042759.BGIv1.0 annot-version=v1.0
ATGACCAGAGAGTATGGAGGGCAGTGGCTCAGCAGCACCACCCGCCACGTTAGGATCTACGCTGCCTACATTGATATCGAGACTGAAACTATGGATCAAA
CCCAGATGGATAAGCTCACTATCATCCTTGATCCCACCGACGAGTTTCTCTGGAACGACGAGACCACCACCAAGGTGTACTCTTACTTCCAGGAGCTTGT
CGATAACTACGAGGGAGCTCCATTAACAGAGTACACGCTACGACTAATCGGTTCAGACATCGAACACTACATAAGGAAGCTGCTGTATGCTGGAGAAATC
AAATACAACATGAGGGCAAAGACGCTCAATTTCAGCATGGGGAAACCGAGGATCCTATTTAATGATGAGGAGAGTCCTGATGTACAATGA
AA sequence
>Lus10042759 pacid=23181775 polypeptide=Lus10042759 locus=Lus10042759.g ID=Lus10042759.BGIv1.0 annot-version=v1.0
MTREYGGQWLSSTTRHVRIYAAYIDIETETMDQTQMDKLTIILDPTDEFLWNDETTTKVYSYFQELVDNYEGAPLTEYTLRLIGSDIEHYIRKLLYAGEI
KYNMRAKTLNFSMGKPRILFNDEESPDVQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G37925 NdhM, NDH-M NADH dehydrogenase-like comple... Lus10042759 0 1
AT4G22950 MADS AGL19 AGAMOUS-like 19 (.1) Lus10014143 2.8 0.9218
Lus10029656 3.2 0.9060
AT1G32470 Single hybrid motif superfamil... Lus10035374 4.0 0.9364
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Lus10002020 6.5 0.9146
AT3G14420 Aldolase-type TIM barrel famil... Lus10013724 11.7 0.9111
AT1G49975 unknown protein Lus10006137 12.1 0.9116
AT1G32470 Single hybrid motif superfamil... Lus10030979 12.2 0.9163
AT1G07700 Thioredoxin superfamily protei... Lus10032343 13.6 0.9162
AT4G11880 MADS AGL14 AGAMOUS-like 14 (.1) Lus10014144 14.4 0.8798
AT1G18170 FKBP-like peptidyl-prolyl cis-... Lus10027246 15.7 0.9159

Lus10042759 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.