Lus10042760 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G77270 57 / 4e-10 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029729 247 / 1e-78 AT1G77270 73 / 4e-13 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G077500 54 / 3e-09 AT1G21560 98 / 4e-22 unknown protein
PFAM info
Representative CDS sequence
>Lus10042760 pacid=23181907 polypeptide=Lus10042760 locus=Lus10042760.g ID=Lus10042760.BGIv1.0 annot-version=v1.0
ATGACCGATTTCGAGTTCAATTCGAATTTGATAAACCAAATTGAATTGCAAATCAAAATCGACGATCTTGATGCTGAACCTGAACGCCCTATTCGGGATT
TTGATTCCGAGTTCAGTGTAAAGCTCATTGCACTTCTTAGAAAGCCGTTCAACAAGAAGGAGTATGATGATCTGATGGAAGAAGTATATGCGAAGAAGCA
GAAGACTAAAGAACAGTTGCTCCGGGGAAGGTCAAAGATGGTCAAAGTGAAAGGTGTTTTTGACAAATCTTATATTGAGCAGCATGAGGATTTTGCCACC
GTGTTCGAAGGCCTGAAGACTAAACTCGAAAGCAATCACCCTGTGAGGCTGAATCTATTGCGTGGATTTTGCTATTGGTTGGGGGTCAGTGTCTTTTCTT
GCTCTCAACTCCTGTCTTATGCTTGCCAAAGCTAA
AA sequence
>Lus10042760 pacid=23181907 polypeptide=Lus10042760 locus=Lus10042760.g ID=Lus10042760.BGIv1.0 annot-version=v1.0
MTDFEFNSNLINQIELQIKIDDLDAEPERPIRDFDSEFSVKLIALLRKPFNKKEYDDLMEEVYAKKQKTKEQLLRGRSKMVKVKGVFDKSYIEQHEDFAT
VFEGLKTKLESNHPVRLNLLRGFCYWLGVSVFSCSQLLSYACQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G77270 unknown protein Lus10042760 0 1
AT3G49170 EMB2261 embryo defective 2261, Tetratr... Lus10004253 2.6 0.8496
AT1G78590 NADK3, ATNADK-3 ARABIDOPSIS THALIANA NADH KINA... Lus10000204 4.6 0.7936
AT4G18593 dual specificity protein phosp... Lus10013914 6.6 0.8047
AT5G58610 PHD finger transcription facto... Lus10003352 7.9 0.7900
AT1G34360 translation initiation factor ... Lus10024699 15.9 0.8049
AT2G37630 MYB AtPHAN, AtMYB91... ARABIDOPSIS PHANTASTICA-LIKE 1... Lus10025355 17.7 0.8022
AT4G02210 unknown protein Lus10013421 18.8 0.7918
AT4G39790 Protein of unknown function (D... Lus10024039 21.1 0.8171
Lus10037427 23.7 0.7328
AT1G34770 unknown protein Lus10020925 24.5 0.7782

Lus10042760 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.