Lus10042765 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33270 532 / 0 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
AT4G33260 530 / 0 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2)
AT5G27570 490 / 1e-173 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1)
AT5G26900 473 / 2e-166 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1)
AT5G27080 471 / 2e-165 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1)
AT5G27945 399 / 1e-137 Transducin/WD40 repeat-like superfamily protein (.1)
AT4G22910 301 / 2e-98 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
AT5G13840 298 / 2e-97 FZR3 FIZZY-related 3 (.1.2)
AT4G11920 294 / 7e-96 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1)
AT5G08390 76 / 2e-14 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042748 751 / 0 AT4G33270 592 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10034687 617 / 0 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10037593 585 / 0 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10006853 577 / 0 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10006851 576 / 0 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10037595 327 / 2e-112 AT4G33270 402 / 2e-141 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10040282 303 / 3e-96 AT5G13840 685 / 0.0 FIZZY-related 3 (.1.2)
Lus10025838 274 / 2e-91 AT4G33270 295 / 3e-99 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10024482 283 / 3e-91 AT4G22910 733 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G021800 542 / 0 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.013G048900 540 / 0 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.016G118400 535 / 0 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.016G068700 485 / 3e-171 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.015G110300 298 / 9e-98 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Potri.010G202100 294 / 1e-95 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2)
Potri.001G112700 289 / 1e-93 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Potri.003G119500 285 / 5e-92 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1)
Potri.008G057500 284 / 9e-92 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2)
Potri.008G002300 76 / 9e-15 AT5G08390 1006 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF00400 WD40 WD domain, G-beta repeat
Representative CDS sequence
>Lus10042765 pacid=23181897 polypeptide=Lus10042765 locus=Lus10042765.g ID=Lus10042765.BGIv1.0 annot-version=v1.0
ATGGGCTTGAATCGTACTAGGATTTTCGCGTTCAAGAACAAGCTTCCCACTCCTGTTGAGTTGATTCCGCATCAGCATACCTGTTCAGATTCTTCTCTTC
CTCCCCAGCCAAAACCAGCCAAGCCTCGCAGACACATTCCTCAGACTCCAGAGAGCAAATTGGACGCTCCAGACATTGTGGATGATTTTTACTTCAACGT
ACTGGACTGGAGCATCAATAATGTTCTGGCGATTGCACTAGGCTGTACAGTTTATCTGTGGGATGCTTCAAACGGCTCTACTTACGAGCTTGTCACCGTT
GATGAAGAGCTTGGCCCTGTTAGGAGCGTTAAATGGGCTCCTGATGGCTGCCATCTCGCCCTCGGTTTGAGCAACTCCCAAGTCCAATTGTGGGATTCTA
TTTGTAACAAACTGGTACAAACATTGAAAGGCGGCCACAGAAGCCTAGTTGGTTCAATGGATTGGAACAGACACATCTTGACCACTGGAGGAATGGACGG
AAGGATCCTAAACACCGATATCAGAACCACGGAACACGTTGTAATGGAATTCCGGGGCCACACACAAGAAGTCTGCGGACTGAAATGGTCGGATTCCGGT
CAACAATTAGCCAGTGGAGGCAACGACAATCTCATCCACATCTGGGACATATCCATGGCTGCTGCTACTTCTTCTTCCAACCCCCAACGGACTCCGTATC
TCCACAGGCTTGAGAACCATACCTCAGCAGTAAAGGCTCTAGCTTGGTGTCCATTCCAACGAAACTTGCTTGCTACAGGAGGCGGCGAAGAAGACAAGAC
GATCAAGTTCTGGAACACCACTACGGGTGCGTGCTTGAACTCGGTGAACACGGGCTCTCCGGTTTGTGCATTGCTGTGGAACAAGAACGAGAGGGAACTC
TTAACCTCTCATGGGTTCCCCGGGAATCAGCTTACCTTGTGGAAGTATCCATCCATGTTGAAGATCGCAGAGCGTACTGGCCATACTTCCAGTGTCCTGT
TCATGGCTCAGAGTCCAGATGGATGCACGGTGGCATCCGCTGCAGGGGATCAAACTCTGAGGGTCTGGTACATGTTTGGGGATCCTAAAGCTGCTGCTGC
AAAGAAGAAGAAAGCGAATCCGGACTCTTGGGTGAATCGCAGCCGGTGCACCATCCGGTGA
AA sequence
>Lus10042765 pacid=23181897 polypeptide=Lus10042765 locus=Lus10042765.g ID=Lus10042765.BGIv1.0 annot-version=v1.0
MGLNRTRIFAFKNKLPTPVELIPHQHTCSDSSLPPQPKPAKPRRHIPQTPESKLDAPDIVDDFYFNVLDWSINNVLAIALGCTVYLWDASNGSTYELVTV
DEELGPVRSVKWAPDGCHLALGLSNSQVQLWDSICNKLVQTLKGGHRSLVGSMDWNRHILTTGGMDGRILNTDIRTTEHVVMEFRGHTQEVCGLKWSDSG
QQLASGGNDNLIHIWDISMAAATSSSNPQRTPYLHRLENHTSAVKALAWCPFQRNLLATGGGEEDKTIKFWNTTTGACLNSVNTGSPVCALLWNKNEREL
LTSHGFPGNQLTLWKYPSMLKIAERTGHTSSVLFMAQSPDGCTVASAAGDQTLRVWYMFGDPKAAAAKKKKANPDSWVNRSRCTIR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33270 AtCDC20.1, CDC2... cell division cycle 20.1, Tran... Lus10042765 0 1
AT4G02290 ATGH9B13 glycosyl hydrolase 9B13 (.1) Lus10008208 4.5 0.8915
AT1G31360 MED34, ATRECQ2,... ARABIDOPSIS THALIANA RECQ 2, ... Lus10033289 12.1 0.8559
AT1G65090 unknown protein Lus10020377 23.9 0.8901
AT5G45950 GDSL-like Lipase/Acylhydrolase... Lus10005279 25.3 0.8669
AT1G17260 AHA10 autoinhibited H\(+\)-ATPase is... Lus10037466 25.6 0.8868
AT5G18030 SAUR-like auxin-responsive pro... Lus10027317 32.4 0.8698
AT3G01140 MYB NOK, ATMYB106 NOECK, myb domain protein 106 ... Lus10019086 36.1 0.8858
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10036782 39.9 0.8765
AT4G01950 ATGPAT3, GPAT3 glycerol-3-phosphate acyltrans... Lus10002421 40.8 0.8820
AT1G04110 SDD1 STOMATAL DENSITY AND DISTRIBUT... Lus10028893 41.6 0.8831

Lus10042765 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.