Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029735 [exp] 65 / 9e-16 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G075850 [exp] 39 / 1e-05 ND / Potri.005G184450 [exp] 39 / 1e-05 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042766 pacid=23181701 polypeptide=Lus10042766 locus=Lus10042766.g ID=Lus10042766.BGIv1.0 annot-version=v1.0 ATGTTGGTTAGTACTTGGAAGCAAAAGCACTGCATTGTTCTTGTGTTGGCTCTTTTGGTGGTGGTGTCAGAGTCAGCCAGATTGCCAAACTGGGAACAAA TGCTGCCAAAGAAGCTTCCAAGACCAGCTTATTCAGCACCTTCCAAGGGTACAAACTCCATCACTGTTTCTTCTTCTTCTACAGACAGATCTCTTCCTTC TTCTGATGGCAAAGTGTAG
AA sequence Show only first row Show all	>Lus10042766 pacid=23181701 polypeptide=Lus10042766 locus=Lus10042766.g ID=Lus10042766.BGIv1.0 annot-version=v1.0 MLVSTWKQKHCIVLVLALLVVVSESARLPNWEQMLPKKLPRPAYSAPSKGTNSITVSSSSTDRSLPSSDGKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10042766 [exp]	0	1
AT3G58190	AS2	LBD29, ASL16	ASYMMETRIC LEAVES 2-LIKE 16, l...		Lus10033873 [exp]	4.0	0.8953
AT5G19440			NAD(P)-binding Rossmann-fold s...		Lus10002302 [exp]	8.7	0.9068
AT2G34930			disease resistance family prot...		Lus10024736 [exp]	8.7	0.9006
AT2G19460			Protein of unknown function (D...		Lus10008471 [exp]	12.2	0.9045
AT4G05220			Late embryogenesis abundant (L...		Lus10018376 [exp]	13.9	0.8262
AT4G32300		SD2-5	S-domain-2 5 (.1)		Lus10002917 [exp]	14.4	0.8944
AT2G34070		TBL37	TRICHOME BIREFRINGENCE-LIKE 37...		Lus10015309 [exp]	17.0	0.9003
AT1G11050			Protein kinase superfamily pro...		Lus10028551 [exp]	18.3	0.8881
					Lus10025502 [exp]	21.2	0.8962
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Lus10007248 [exp]	22.0	0.9027

Compare expression of checked genes

Lus10042766 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.