Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78790 86 / 4e-23 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042782 [exp] 168 / 1e-55 AT1G78790 124 / 2e-38 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G090600 [exp] 102 / 1e-29 AT1G78790 140 / 1e-44 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF09415 [flax] [poplar] CENP-X CENP-S associating Centromere protein X
Representative CDS sequence Show only first row Show all	>Lus10042781 pacid=23181985 polypeptide=Lus10042781 locus=Lus10042781.g ID=Lus10042781.BGIv1.0 annot-version=v1.0 ATGATGGATGAAACTATGTTGGAGCCTGGTTTGATTCACGAGATTTTCAAGCACGTCTGGAACAGACCATCCCAAGAGCGGGAGAAAAATGAAGTCAATG ACGTCCCTATGGACAATGATGCGGCTACTGTAGGAACTGGAACGTCCAAGAAGAATCGCCCTACTTCCGCTAACGCTAATGCAGTGAAGTTGAGCGCTGA ACTCATTCAGATTTTCATAGCAGAGGCTGTGCAGCGTGCCGCGGCTATTGCTGAAGCTGAGGGAGAGACCAAAATTGAAGCTACTCACTTTGAAAGAATT CTTCCCCAGTTGCTCCTGGATTTTTGA
AA sequence Show only first row Show all	>Lus10042781 pacid=23181985 polypeptide=Lus10042781 locus=Lus10042781.g ID=Lus10042781.BGIv1.0 annot-version=v1.0 MMDETMLEPGLIHEIFKHVWNRPSQEREKNEVNDVPMDNDAATVGTGTSKKNRPTSANANAVKLSAELIQIFIAEAVQRAAAIAEAEGETKIEATHFERI LPQLLLDF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G78790			unknown protein		Lus10042781 [exp]	0	1
AT5G58005			Cytochrome c oxidase, subunit ...		Lus10036285 [exp]	4.0	0.7503
AT1G33590			Leucine-rich repeat (LRR) fami...		Lus10002937 [exp]	9.2	0.7189
AT5G64180			unknown protein		Lus10008120 [exp]	10.7	0.7610
AT1G50170		ATSIRB	sirohydrochlorin ferrochelatas...		Lus10022245 [exp]	11.2	0.6725
AT2G28470		BGAL8	beta-galactosidase 8 (.1.2)		Lus10011237 [exp]	11.4	0.7336
AT4G29170		ATMND1	Mnd1 family protein (.1.2)		Lus10002503 [exp]	12.8	0.7316
AT3G14110		FLU	FLUORESCENT IN BLUE LIGHT, Tet...		Lus10037686 [exp]	14.7	0.7095
AT3G05250			RING/U-box superfamily protein...		Lus10029940 [exp]	20.3	0.6846
AT2G30410		TFCA, KIS	TUBULIN FOLDING FACTOR A, tubu...		Lus10031323 [exp]	22.8	0.6819
AT3G62810			complex 1 family protein / LVR...		Lus10021599 [exp]	24.3	0.7008

Compare expression of checked genes

Lus10042781 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.