Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78790 86 / 4e-23 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042781 [exp] 168 / 1e-55 AT1G78790 124 / 2e-38 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G090600 [exp] 102 / 1e-29 AT1G78790 140 / 1e-44 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF09415 [flax] [poplar] CENP-X CENP-S associating Centromere protein X
Representative CDS sequence Show only first row Show all	>Lus10042782 pacid=23181957 polypeptide=Lus10042782 locus=Lus10042782.g ID=Lus10042782.BGIv1.0 annot-version=v1.0 ATGATGGATGAAACTATGTTGGAGCCTGGTTTGATTCACGAGATTTTCAAGCACGTCTGGAACAGACCATCCCAAGAGCGGGAGAAAAATGAAGTCAATG ACGTCCCTATGGACAATGATGCGGCTACTGTAGGAACTGGAACGTCCAAGAAGAATCGCCCTACTTCCGCTAACGCTAATGCAGTGAAGTTGAGCGCTGA ACTCATTCAGATTTTCATAGCAGAGGCTGTGCAGCGTGCCGCGGCTATTGCTGAAGCTGAGGGAGAGACCAAAATTGAAGCTACTCACTTTGAAAGAATT CTTCCCCAGTTGCTCCTGGATTTTTGA
AA sequence Show only first row Show all	>Lus10042782 pacid=23181957 polypeptide=Lus10042782 locus=Lus10042782.g ID=Lus10042782.BGIv1.0 annot-version=v1.0 MMDETMLEPGLIHEIFKHVWNRPSQEREKNEVNDVPMDNDAATVGTGTSKKNRPTSANANAVKLSAELIQIFIAEAVQRAAAIAEAEGETKIEATHFERI LPQLLLDF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G78790			unknown protein		Lus10042782 [exp]	0	1
AT4G10550			Subtilase family protein (.1.2...		Lus10035478 [exp]	4.2	0.8446
AT4G36890		IRX14	irregular xylem 14, Nucleotide...		Lus10033785 [exp]	7.1	0.8688
AT3G10850		GLY2, GLX2-2	GLYOXALASE 2-2, Metallo-hydrol...		Lus10029086 [exp]	8.2	0.8563
AT2G38900			Serine protease inhibitor, pot...		Lus10003225 [exp]	8.5	0.8489
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10042904 [exp]	11.0	0.8711
AT4G12230			alpha/beta-Hydrolases superfam...		Lus10032207 [exp]	11.9	0.8591
AT3G55005		TON1B	tonneau 1b (TON1b) (.1)		Lus10023478 [exp]	13.8	0.8532
AT1G59520		CW7	CW7 (.1.2.3)		Lus10012485 [exp]	14.7	0.8458
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Lus10014329 [exp]	21.2	0.8429
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10009535 [exp]	22.7	0.7815

Compare expression of checked genes

Lus10042782 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.