Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15360 165 / 4e-52 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT4G03520 159 / 8e-50 ATHM2 Thioredoxin superfamily protein (.1.2) AT1G03680 145 / 1e-44 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT2G15570 116 / 2e-33 TRX-M3, GAT1, ATHM3, ATM3 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) AT1G76760 89 / 1e-22 ATY1, TRX-Y1 thioredoxin Y1 (.1) AT1G43560 84 / 6e-21 ATY2 thioredoxin Y2 (.1) AT1G19730 74 / 3e-17 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT3G51030 73 / 3e-17 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT5G42980 73 / 4e-17 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G50320 74 / 6e-17 ATHX, ATX thioredoxin X (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029752 [exp] 343 / 5e-123 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 318 / 5e-113 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10014798 [exp] 173 / 1e-55 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10040887 [exp] 171 / 8e-55 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10014069 [exp] 117 / 1e-33 AT2G15570 182 / 3e-59 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10019847 [exp] 114 / 3e-32 AT2G15570 184 / 8e-60 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10028569 [exp] 83 / 3e-20 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1) Lus10018875 [exp] 82 / 7e-20 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1) Lus10024293 [exp] 72 / 2e-16 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G186800 [exp] 189 / 8e-62 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.002G073000 [exp] 186 / 3e-60 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.005G058400 [exp] 183 / 2e-59 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2) Potri.001G401500 [exp] 177 / 5e-57 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.011G120700 [exp] 171 / 1e-54 AT3G15360 190 / 1e-61 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.013G132200 [exp] 154 / 7e-48 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2) Potri.019G111200 [exp] 153 / 1e-47 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2) Potri.009G100700 [exp] 119 / 1e-34 AT2G15570 193 / 2e-63 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Potri.005G193400 [exp] 86 / 1e-21 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1) Potri.002G066800 [exp] 82 / 5e-20 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10042784 pacid=23181765 polypeptide=Lus10042784 locus=Lus10042784.g ID=Lus10042784.BGIv1.0 annot-version=v1.0 ATGGCGATGACCAATTGCTTCCAAGTAACAAGCTCCTCCTGCAAGGTTGGAATCACTACCGTTCAGGCCACCCATTCTTTTACTTCTTCTGCAGACAGAC TCAACTTCAGAAGAGAATTCAACCCAGTTACCCTTTTCCCAACAACTTCCAACCCAAGGAGATCCAATTTCGTCTGCAAAGCTCAAGAAGCTGTTGAAGT TAAACCAGTGACGGAGGCAGAATGGGAGAAGTTGGTGGTTGGAAGTGAAATCCCAGTACTGGTGGACTTCTGGGCGCCATGGTGCGGACCATGCCGGATG ATAGCTCCCGTGATCGACGAGCTGGCGAAGGAGTACGCCGGGAAGATAGCTTGTTACAAGGTGAACACGGATGAGAGCCCCAACATTGCAAGCCGGTATG GAATCAGGAGCATCCCAACTGTGCTTTTCTTCAACAAGGGTGAGAAGAAAGAGAGCATTATCGGTGCTGTCCCTAAGACCACTTTGTGTAGTACACTAGA GAAGTTCCTTTGA
AA sequence Show only first row Show all	>Lus10042784 pacid=23181765 polypeptide=Lus10042784 locus=Lus10042784.g ID=Lus10042784.BGIv1.0 annot-version=v1.0 MAMTNCFQVTSSSCKVGITTVQATHSFTSSADRLNFRREFNPVTLFPTTSNPRRSNFVCKAQEAVEVKPVTEAEWEKLVVGSEIPVLVDFWAPWCGPCRM IAPVIDELAKEYAGKIACYKVNTDESPNIASRYGIRSIPTVLFFNKGEKKESIIGAVPKTTLCSTLEKFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15360		ATHM4, ATM4, TR...	ARABIDOPSIS THIOREDOXIN M-TYPE...		Lus10042784 [exp]	0	1
AT3G15360		ATHM4, ATM4, TR...	ARABIDOPSIS THIOREDOXIN M-TYPE...		Lus10029755 [exp]	1.0	0.9927
AT5G62840			Phosphoglycerate mutase family...		Lus10007865 [exp]	1.4	0.9646
AT5G45040		CYTC6A	cytochrome c6A, Cytochrome c (...		Lus10036207 [exp]	2.6	0.9485
AT2G21960			unknown protein		Lus10005779 [exp]	3.5	0.9491
AT4G01150			unknown protein		Lus10012645 [exp]	3.9	0.9540
AT4G31530			NAD(P)-binding Rossmann-fold s...		Lus10022420 [exp]	4.2	0.9426
AT5G22800		EMB86, EMB263, ...	EMBRYO DEFECTIVE 86, EMBRYO DE...		Lus10003337 [exp]	4.5	0.9533
AT5G19940			Plastid-lipid associated prote...		Lus10026221 [exp]	6.3	0.9453
AT1G73060		LPA3	Low PSII Accumulation 3 (.1)		Lus10026089 [exp]	6.3	0.9426
AT4G01150			unknown protein		Lus10010132 [exp]	6.7	0.9496

Compare expression of checked genes

Lus10042784 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.