Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15733 65 / 3e-15 SCRL11 SCR-like 11 (.1) AT4G15735 52 / 3e-10 SCRL10 SCR-like 10 (.1) AT4G22115 49 / 5e-09 SCRL14 SCR-like 14 (.1) AT2G05117 45 / 1e-07 SCRL9 SCR-like 9 (.1) AT4G22105 44 / 5e-07 SCRL26 SCR-like 26 (.1) AT1G60986 37 / 0.0003 SCRL4 SCR-like 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033371 [exp] 133 / 2e-42 AT4G15733 71 / 6e-18 SCR-like 11 (.1) Lus10029762 [exp] 129 / 4e-41 AT4G15733 60 / 1e-13 SCR-like 11 (.1) Lus10034823 [exp] 125 / 8e-39 AT4G15733 66 / 7e-15 SCR-like 11 (.1) Lus10034824 [exp] 122 / 1e-37 AT4G15733 63 / 9e-14 SCR-like 11 (.1) Lus10033373 [exp] 118 / 2e-34 ND 64 / 3e-13 Lus10010504 [exp] 87 / 5e-24 AT4G22115 42 / 1e-06 SCR-like 14 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G162300 [exp] 81 / 1e-21 AT4G15733 57 / 3e-12 SCR-like 11 (.1) Potri.004G201100 [exp] 73 / 1e-18 AT4G15733 50 / 8e-10 SCR-like 11 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [flax] [poplar] Knottin_1 PF06876 [flax] [poplar] SCRL Plant self-incompatibility response (SCRL) protein
Representative CDS sequence Show only first row Show all	>Lus10042791 pacid=23181943 polypeptide=Lus10042791 locus=Lus10042791.g ID=Lus10042791.BGIv1.0 annot-version=v1.0 ATGTCGTCGAAGATTGCAATGATCATCGTCCTGTTCTGCATCGTAGTCTTCCAATCCGCTGTTGCATCGAACGAAGATGATCTTAAGTGGTGTCCAAAGA AGGATGTGTTCACAGGAGGATGTGGAGGGCCACAGCAAAATCAATGTCTTCTGGACTTCTTAGGAAAGTACGGAGCTAGCAGCATGCCCAAAAACTGCAT TTGCACTCCTGCCGGCACTGCACATTCTTGCACCTGCCAAGTTGTTTGTGGTTGTTGCTAA
AA sequence Show only first row Show all	>Lus10042791 pacid=23181943 polypeptide=Lus10042791 locus=Lus10042791.g ID=Lus10042791.BGIv1.0 annot-version=v1.0 MSSKIAMIIVLFCIVVFQSAVASNEDDLKWCPKKDVFTGGCGGPQQNQCLLDFLGKYGASSMPKNCICTPAGTAHSCTCQVVCGCC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15733		SCRL11	SCR-like 11 (.1)		Lus10042791 [exp]	0	1
AT2G29490		GST19, ATGSTU1	GLUTATHIONE S-TRANSFERASE 19, ...		Lus10007896 [exp]	4.7	0.8782
AT1G03050			ENTH/ANTH/VHS superfamily prot...		Lus10000201 [exp]	10.5	0.7688
					Lus10004306 [exp]	12.5	0.6720
AT1G25270			nodulin MtN21 /EamA-like trans...		Lus10015066 [exp]	13.4	0.8043
AT1G14190			Glucose-methanol-choline (GMC)...		Lus10026606 [exp]	15.4	0.7505
AT3G50845			Protein of unknown function (D...		Lus10014311 [exp]	16.2	0.8012
AT4G15050			Protein of Unknown Function (D...		Lus10002231 [exp]	18.8	0.7520
AT3G05610			Plant invertase/pectin methyle...		Lus10015211 [exp]	19.9	0.7862
AT4G31500		SUR2, RNT1, RED...	SUPERROOT 2, RUNT 1, RED ELONG...		Lus10034502 [exp]	21.4	0.7831
					Lus10013963 [exp]	22.7	0.7819

Compare expression of checked genes

Lus10042791 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.