Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78780 115 / 2e-33 pathogenesis-related family protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029763 [exp] 183 / 2e-59 AT1G78780 228 / 3e-75 pathogenesis-related family protein (.1.2.3.4) Lus10018919 [exp] 140 / 1e-42 AT1G78780 239 / 1e-79 pathogenesis-related family protein (.1.2.3.4) Lus10035732 [exp] 116 / 1e-33 AT1G78780 249 / 2e-85 pathogenesis-related family protein (.1.2.3.4) Lus10037316 [exp] 114 / 6e-32 AT1G78780 337 / 9e-118 pathogenesis-related family protein (.1.2.3.4) Lus10039018 [exp] 102 / 6e-28 AT1G78780 301 / 6e-104 pathogenesis-related family protein (.1.2.3.4) Lus10027315 [exp] 97 / 1e-26 AT1G78780 171 / 3e-55 pathogenesis-related family protein (.1.2.3.4) Lus10028620 [exp] 47 / 9e-08 AT1G78780 67 / 1e-15 pathogenesis-related family protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G188400 [exp] 146 / 5e-45 AT1G78780 249 / 1e-83 pathogenesis-related family protein (.1.2.3.4) Potri.005G188300 [exp] 144 / 4e-44 AT1G78780 251 / 2e-84 pathogenesis-related family protein (.1.2.3.4) Potri.011G108900 [exp] 110 / 7e-31 AT1G78780 365 / 4e-129 pathogenesis-related family protein (.1.2.3.4) Potri.001G389800 [exp] 107 / 1e-29 AT1G78780 361 / 9e-128 pathogenesis-related family protein (.1.2.3.4) Potri.001G389400 [exp] 106 / 3e-29 AT1G78780 352 / 4e-124 pathogenesis-related family protein (.1.2.3.4)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042792 pacid=23182065 polypeptide=Lus10042792 locus=Lus10042792.g ID=Lus10042792.BGIv1.0 annot-version=v1.0 ATGGCCAAACCAAGGGAGAAAACCAACCAACCTGAAAGAAACGGGAAAGCTAGGAGGGAGCTACAATTTCTTCCTCCAGACATCGTGCCTGTAGAAATGA GGGGTTACAACCCTGCAGAGGAAACAGCAGAGACATCTCATTCAACTTTCACTACTGTTTTCCCTAGCGGGTTTGTGTTGGAGATTCTGCAGGTCTACTC GGGTCCTCCCGTGATTGCGTTCAAGTTCAGGCACTGGGTATTTATGGAGGGTCCGTATAAAGGCCACCCACCCACCGGGAAAATGATTCAGTTCTTTGGA ACGGCTGTGTTTGAGGTTGATGAACACATGAAGATTATCAAGGTGGAGTTCTTCATGGACCGTGGTGAACGGGCATCTTGA
AA sequence Show only first row Show all	>Lus10042792 pacid=23182065 polypeptide=Lus10042792 locus=Lus10042792.g ID=Lus10042792.BGIv1.0 annot-version=v1.0 MAKPREKTNQPERNGKARRELQFLPPDIVPVEMRGYNPAEETAETSHSTFTTVFPSGFVLEILQVYSGPPVIAFKFRHWVFMEGPYKGHPPTGKMIQFFG TAVFEVDEHMKIIKVEFFMDRGERAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G78780			pathogenesis-related family pr...		Lus10042792 [exp]	0	1
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Lus10020437 [exp]	1.0	0.9649
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10039348 [exp]	3.0	0.9579
AT5G17000			Zinc-binding dehydrogenase fam...		Lus10004379 [exp]	3.7	0.9628
AT5G10530			Concanavalin A-like lectin pro...		Lus10004277 [exp]	6.0	0.9434
AT5G61820			unknown protein		Lus10003210 [exp]	6.3	0.9282
AT5G06740			Concanavalin A-like lectin pro...		Lus10016257 [exp]	6.5	0.9469
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10016469 [exp]	7.1	0.9546
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Lus10016310 [exp]	8.0	0.9442
AT2G30140			UDP-Glycosyltransferase superf...		Lus10042261 [exp]	8.2	0.9571
AT5G39220			alpha/beta-Hydrolases superfam...		Lus10032977 [exp]	8.7	0.9315

Compare expression of checked genes

Lus10042792 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.