Lus10042794 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G21326 67 / 4e-14 VQ motif-containing protein (.1)
AT1G21320 62 / 4e-12 nucleotide binding;nucleic acid binding (.1.2)
AT1G68450 60 / 4e-12 PDE337 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
AT3G18360 56 / 6e-10 VQ motif-containing protein (.1)
AT3G18690 55 / 7e-10 MKS1 MAP kinase substrate 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029768 159 / 2e-50 AT1G21326 79 / 4e-18 VQ motif-containing protein (.1)
Lus10009033 62 / 4e-12 AT3G18360 110 / 5e-29 VQ motif-containing protein (.1)
Lus10012286 44 / 8e-07 AT1G21326 50 / 8e-09 VQ motif-containing protein (.1)
Lus10004172 40 / 0.0003 AT2G42140 72 / 2e-15 VQ motif-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G189300 100 / 1e-26 AT1G21326 75 / 4e-16 VQ motif-containing protein (.1)
Potri.002G070600 86 / 2e-21 AT1G21326 76 / 3e-16 VQ motif-containing protein (.1)
Potri.005G057800 67 / 3e-14 AT3G18690 124 / 2e-35 MAP kinase substrate 1 (.1)
Potri.015G046600 58 / 5e-11 AT3G18360 81 / 2e-18 VQ motif-containing protein (.1)
Potri.012G055900 57 / 1e-10 AT3G18360 73 / 2e-15 VQ motif-containing protein (.1)
Potri.006G199300 54 / 2e-10 AT1G68450 60 / 1e-12 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
Potri.010G123700 55 / 1e-09 AT1G68450 64 / 9e-13 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
Potri.007G110100 52 / 7e-09 AT3G18690 119 / 3e-33 MAP kinase substrate 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Lus10042794 pacid=23181848 polypeptide=Lus10042794 locus=Lus10042794.g ID=Lus10042794.BGIv1.0 annot-version=v1.0
ATGGATTCATCATCATCTGACTCCAGATCGCCCAGGAAAGAGCTGCAAGGTCCCCGCCCTCCTGCTCTCAAAGTCCGCAAAGATTCCCACCAAATCAGAA
AGCCCCCCGTCGCTCCCAAACCCAACCCCAACCTAACTAACCCCCCTATCCACCATCAATTGAATCAGCAGCCACGCGCTCCGGTCATCATCTACACCGT
TTCCCCTAAAGTGATTCACACAAACCCCGACGATTTCATGACCCTAGTTCAACGCCTCACCGGCTCCCCCCTCTCTTCTTCTTTCTCAGCCGCCTCCTCC
TCCAACCCTTTTAGCGATGACGGCGCGCCGGCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGCAGCAGGAATGTGATGGCTGGTACGGGG
CTATTGCAGAGCCCGGGTAA
AA sequence
>Lus10042794 pacid=23181848 polypeptide=Lus10042794 locus=Lus10042794.g ID=Lus10042794.BGIv1.0 annot-version=v1.0
MDSSSSDSRSPRKELQGPRPPALKVRKDSHQIRKPPVAPKPNPNLTNPPIHHQLNQQPRAPVIIYTVSPKVIHTNPDDFMTLVQRLTGSPLSSSFSAASS
SNPFSDDGAPAXXXXXXXXXXXXEQQECDGWYGAIAEPG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G21326 VQ motif-containing protein (.... Lus10042794 0 1
AT1G80840 WRKY ATWRKY40, WRKY4... WRKY DNA-binding protein 40 (.... Lus10026082 7.3 0.8118
AT1G76600 unknown protein Lus10037249 7.6 0.8108
AT2G45760 BAL, BAP2 BON ASSOCIATION PROTEIN 1-LIKE... Lus10036571 9.2 0.7981
AT1G29290 unknown protein Lus10029256 11.8 0.7974
AT3G15518 unknown protein Lus10037893 12.3 0.7904
AT5G41330 BTB/POZ domain with WD40/YVTN ... Lus10024643 16.4 0.7997
AT1G80840 WRKY ATWRKY40, WRKY4... WRKY DNA-binding protein 40 (.... Lus10002309 19.6 0.7943
AT1G74950 ZIM TIFY10B, JAZ2 JASMONATE-ZIM-DOMAIN PROTEIN 2... Lus10013166 21.2 0.7932
AT1G18210 Calcium-binding EF-hand family... Lus10009059 21.4 0.7843
AT2G40095 Alpha/beta hydrolase related p... Lus10014849 22.0 0.7679

Lus10042794 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.