Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G42130 161 / 4e-49 AtMfl1 MitoFerrinLike1, Mitochondrial substrate carrier family protein (.1) AT1G34065 73 / 3e-16 SAMC2 S-adenosylmethionine carrier 2 (.1) AT4G39460 67 / 4e-14 SAMC1, SAMT1 SAM TRANSPORTER1, S-adenosylmethionine carrier 1 (.1.2) AT5G15640 62 / 3e-12 Mitochondrial substrate carrier family protein (.1) AT2G26360 59 / 3e-11 Mitochondrial substrate carrier family protein (.1) AT2G35800 59 / 3e-11 SAMTL S-adenosyl methionine transporter-like, mitochondrial substrate carrier family protein (.1) AT4G11440 57 / 1e-10 Mitochondrial substrate carrier family protein (.1) AT5G61810 54 / 1e-09 APC1 ATP/phosphate carrier 1, Mitochondrial substrate carrier family protein (.1.2) AT2G37890 53 / 3e-09 Mitochondrial substrate carrier family protein (.1) AT5G51050 53 / 4e-09 APC2 ATP/phosphate carrier 2, Mitochondrial substrate carrier family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029770 [exp] 211 / 6e-69 AT5G42130 478 / 5e-169 MitoFerrinLike1, Mitochondrial substrate carrier family protein (.1) Lus10005787 [exp] 69 / 5e-15 AT4G39460 494 / 2e-177 SAM TRANSPORTER1, S-adenosylmethionine carrier 1 (.1.2) Lus10006812 [exp] 69 / 6e-15 AT4G39460 478 / 6e-171 SAM TRANSPORTER1, S-adenosylmethionine carrier 1 (.1.2) Lus10040375 [exp] 64 / 9e-13 AT2G35800 1066 / 0.0 S-adenosyl methionine transporter-like, mitochondrial substrate carrier family protein (.1) Lus10023493 [exp] 63 / 2e-12 AT2G35800 1056 / 0.0 S-adenosyl methionine transporter-like, mitochondrial substrate carrier family protein (.1) Lus10035134 [exp] 57 / 2e-10 AT5G15640 477 / 2e-170 Mitochondrial substrate carrier family protein (.1) Lus10041498 [exp] 54 / 3e-09 AT5G15640 494 / 2e-177 Mitochondrial substrate carrier family protein (.1) Lus10012597 [exp] 54 / 3e-09 AT5G15640 488 / 9e-173 Mitochondrial substrate carrier family protein (.1) Lus10024344 [exp] 53 / 5e-09 AT3G53940 417 / 4e-147 Mitochondrial substrate carrier family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G189600 [exp] 167 / 8e-52 AT5G42130 542 / 0.0 MitoFerrinLike1, Mitochondrial substrate carrier family protein (.1) Potri.005G197200 [exp] 66 / 9e-14 AT4G39460 417 / 3e-147 SAM TRANSPORTER1, S-adenosylmethionine carrier 1 (.1.2) Potri.005G085900 [exp] 65 / 2e-13 AT4G39460 487 / 9e-175 SAM TRANSPORTER1, S-adenosylmethionine carrier 1 (.1.2) Potri.008G043700 [exp] 62 / 2e-12 AT2G35800 1044 / 0.0 S-adenosyl methionine transporter-like, mitochondrial substrate carrier family protein (.1) Potri.010G217900 [exp] 61 / 5e-12 AT2G35800 1040 / 0.0 S-adenosyl methionine transporter-like, mitochondrial substrate carrier family protein (.1) Potri.003G127600 [exp] 60 / 2e-11 AT4G11440 437 / 3e-146 Mitochondrial substrate carrier family protein (.1) Potri.017G098500 [exp] 57 / 1e-10 AT5G15640 460 / 3e-164 Mitochondrial substrate carrier family protein (.1) Potri.004G117000 [exp] 57 / 1e-10 AT5G15640 434 / 1e-153 Mitochondrial substrate carrier family protein (.1) Potri.012G110700 [exp] 57 / 2e-10 AT5G51050 714 / 0.0 ATP/phosphate carrier 2, Mitochondrial substrate carrier family protein (.1) Potri.008G100100 [exp] 56 / 2e-10 AT5G15640 338 / 5e-116 Mitochondrial substrate carrier family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00153 [flax] [poplar] Mito_carr Mitochondrial carrier protein
Representative CDS sequence Show only first row Show all	>Lus10042797 pacid=23181735 polypeptide=Lus10042797 locus=Lus10042797.g ID=Lus10042797.BGIv1.0 annot-version=v1.0 ATGCAGCCGATTGAGAGCGTGGTGTGTGGGGCATTGGCTGGTGCTATATCAGCATCGTTGACTACTCCGCTGGATGTTGTGAAGACGAGGATGATGACTC AGGTGAGTGGAGAAGCTGCGAGGAAAGTTTCGGATATGGTGAAGCAGATATTGGTGGAGGAAGGATGGGTTGGGTTCACCAGAGGGATGGGGCCGAGAGT GCTTCACAGTGCTTGTTTCTCTGCGATTGGTTATTTTGCGTTTGAGACTGCCAGGTTGGAGCTTCTGAATCGGTATTTGAAGCATAAGGAGCTTCAGGAA TTGAATGATGCAGGAGCAGTCACCCTGGGGGAAGAAGCCAGATTGAGGAAGTAA
AA sequence Show only first row Show all	>Lus10042797 pacid=23181735 polypeptide=Lus10042797 locus=Lus10042797.g ID=Lus10042797.BGIv1.0 annot-version=v1.0 MQPIESVVCGALAGAISASLTTPLDVVKTRMMTQVSGEAARKVSDMVKQILVEEGWVGFTRGMGPRVLHSACFSAIGYFAFETARLELLNRYLKHKELQE LNDAGAVTLGEEARLRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G42130		AtMfl1	MitoFerrinLike1, Mitochondrial...		Lus10042797 [exp]	0	1
AT5G42130		AtMfl1	MitoFerrinLike1, Mitochondrial...		Lus10042796 [exp]	1.0	0.8691
AT2G22170			Lipase/lipooxygenase, PLAT/LH2...		Lus10037491 [exp]	2.8	0.8234
AT2G18630			Protein of unknown function (D...		Lus10040334 [exp]	6.6	0.7805
AT3G02510			Regulator of chromosome conden...		Lus10017581 [exp]	6.7	0.7915
AT1G05590		HEXO2, ATHEX3	BETA-HEXOSAMINIDASE 3, beta-he...		Lus10030348 [exp]	8.0	0.7232
AT5G47850		CCR4	CRINKLY4 related 4 (.1)		Lus10012995 [exp]	9.5	0.7698
AT5G63380			AMP-dependent synthetase and l...		Lus10002791 [exp]	13.2	0.7754
AT1G51660		ATMKK4, ATMEK4	ARABIDOPSIS THALIANA MITOGEN-A...		Lus10035764 [exp]	13.4	0.7760
AT1G70780			unknown protein		Lus10034416 [exp]	14.5	0.7756
AT3G46790		CRR2	CHLORORESPIRATORY REDUCTION 2,...		Lus10001557 [exp]	18.5	0.7069

Compare expression of checked genes

Lus10042797 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.