Lus10042801 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10042801 pacid=23181966 polypeptide=Lus10042801 locus=Lus10042801.g ID=Lus10042801.BGIv1.0 annot-version=v1.0
ATGTTTCTCTCCTCGGAGGAGCCGCTACCCATCTTGCTTGCCACCTCCGCTCTTTCTCCTATACCGTCTTTCCCAGTTTTCCTCGCCATCCGTCTCTGGT
GGCCGGCGGCATCTGACTTCCTTCCCGTCTCCGGGATCTGCATCCGACCTCCTAAACCGTCTCCATTTCTGTTGCCTAACTAA
AA sequence
>Lus10042801 pacid=23181966 polypeptide=Lus10042801 locus=Lus10042801.g ID=Lus10042801.BGIv1.0 annot-version=v1.0
MFLSSEEPLPILLATSALSPIPSFPVFLAIRLWWPAASDFLPVSGICIRPPKPSPFLLPN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10042801 0 1
AT1G27750 nucleic acid binding (.1) Lus10007756 14.1 0.7806
AT1G08420 BSL2 BRI1 suppressor 1 (BSU1)-like ... Lus10008369 15.0 0.8499
AT1G77300 ASHH2, CCR1, SD... LAZARUS 2, CAROTENOID CHLOROPL... Lus10028662 23.7 0.8395
AT5G07740 actin binding (.1) Lus10015724 25.9 0.8376
AT4G39420 unknown protein Lus10014010 26.3 0.8062
AT1G22275 ZYP1b Myosin heavy chain-related pro... Lus10036473 28.3 0.7730
AT5G01730 ATSCAR4, WAVE3 SCAR family protein 4 (.1) Lus10029437 30.2 0.8359
AT4G15802 AtHSBP Arabidopsis thaliana heat shoc... Lus10000501 52.9 0.8139
AT3G14010 CID4 CTC-interacting domain 4 (.1.2... Lus10037656 53.2 0.8143
AT5G56700 FBD / Leucine Rich Repeat doma... Lus10017238 82.0 0.7485

Lus10042801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.