Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G03970 53 / 8e-10 bZIP GBF4 G-box binding factor 4 (.1) AT5G44080 53 / 9e-10 bZIP Basic-leucine zipper (bZIP) transcription factor family protein (.1) AT1G45249 45 / 6e-07 bZIP AtABF2, ATAREB1, AREB1, ABF2 ABSCISIC ACID RESPONSIVE ELEMENTS-BINDING PROTEIN 2, abscisic acid responsive elements-binding factor 2 (.1.2.3) AT2G36270 44 / 1e-06 bZIP EEL, GIA1, ABI5 GROWTH-INSENSITIVITY TO ABA 1, ABA INSENSITIVE 5, Basic-leucine zipper (bZIP) transcription factor family protein (.1) AT4G34000 44 / 2e-06 bZIP AtABF3, ABF3, DPBF5 DC3 PROMOTER-BINDING FACTOR 5, abscisic acid responsive elements-binding factor 3 (.1.2.3) AT1G49720 44 / 2e-06 bZIP ABF1 abscisic acid responsive element-binding factor 1 (.1.2) AT3G19290 43 / 3e-06 bZIP AREB2, ABF4 ABA-RESPONSIVE ELEMENT BINDING PROTEIN 2, ABRE binding factor 4 (.1.2.3) AT2G17770 41 / 1e-05 bZIP FDP, ATBZIP27 FD PARALOG, basic region/leucine zipper motif 27 (.1.2) AT3G56850 41 / 2e-05 bZIP DPBF3, AREB3 ABA-responsive element binding protein 3 (.1) AT2G41070 40 / 2e-05 bZIP DPBF4, ATBZIP12, EEL ENHANCED EM LEVEL, Basic-leucine zipper (bZIP) transcription factor family protein (.1), Basic-leucine zipper (bZIP) transcription factor family protein (.2), Basic-leucine zipper (bZIP) transcription factor family protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017049 [exp] 44 / 1e-06 AT2G36270 321 / 1e-106 GROWTH-INSENSITIVITY TO ABA 1, ABA INSENSITIVE 5, Basic-leucine zipper (bZIP) transcription factor family protein (.1) Lus10022720 [exp] 44 / 2e-06 AT2G36270 312 / 2e-103 GROWTH-INSENSITIVITY TO ABA 1, ABA INSENSITIVE 5, Basic-leucine zipper (bZIP) transcription factor family protein (.1) Lus10021369 [exp] 44 / 2e-06 AT2G36270 322 / 2e-107 GROWTH-INSENSITIVITY TO ABA 1, ABA INSENSITIVE 5, Basic-leucine zipper (bZIP) transcription factor family protein (.1) Lus10009755 [exp] 44 / 3e-06 AT1G45249 283 / 3e-91 ABSCISIC ACID RESPONSIVE ELEMENTS-BINDING PROTEIN 2, abscisic acid responsive elements-binding factor 2 (.1.2.3) Lus10014194 [exp] 44 / 3e-06 AT2G36270 342 / 2e-114 GROWTH-INSENSITIVITY TO ABA 1, ABA INSENSITIVE 5, Basic-leucine zipper (bZIP) transcription factor family protein (.1) Lus10014066 [exp] 43 / 3e-06 AT3G19290 345 / 1e-115 ABA-RESPONSIVE ELEMENT BINDING PROTEIN 2, ABRE binding factor 4 (.1.2.3) Lus10027897 [exp] 43 / 4e-06 AT3G19290 289 / 1e-93 ABA-RESPONSIVE ELEMENT BINDING PROTEIN 2, ABRE binding factor 4 (.1.2.3) Lus10002399 [exp] 43 / 5e-06 AT3G19290 203 / 2e-61 ABA-RESPONSIVE ELEMENT BINDING PROTEIN 2, ABRE binding factor 4 (.1.2.3) Lus10006489 [exp] 42 / 7e-06 AT1G45249 297 / 1e-97 ABSCISIC ACID RESPONSIVE ELEMENTS-BINDING PROTEIN 2, abscisic acid responsive elements-binding factor 2 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G067400 [exp] 56 / 8e-11 AT5G44080 141 / 2e-39 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Potri.009G164500 [exp] 44 / 2e-06 AT3G44460 160 / 2e-46 basic leucine zipper transcription factor 67, Basic-leucine zipper (bZIP) transcription factor family protein (.1) Potri.006G083000 [exp] 44 / 2e-06 AT2G36270 313 / 1e-103 GROWTH-INSENSITIVITY TO ABA 1, ABA INSENSITIVE 5, Basic-leucine zipper (bZIP) transcription factor family protein (.1) Potri.009G101200 [exp] 44 / 2e-06 AT4G34000 358 / 2e-120 DC3 PROMOTER-BINDING FACTOR 5, abscisic acid responsive elements-binding factor 3 (.1.2.3) Potri.002G125400 [exp] 43 / 3e-06 AT1G45249 306 / 4e-100 ABSCISIC ACID RESPONSIVE ELEMENTS-BINDING PROTEIN 2, abscisic acid responsive elements-binding factor 2 (.1.2.3) Potri.002G018400 [exp] 43 / 3e-06 AT4G35900 133 / 5e-38 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Potri.014G028200 [exp] 43 / 3e-06 AT1G45249 317 / 2e-105 ABSCISIC ACID RESPONSIVE ELEMENTS-BINDING PROTEIN 2, abscisic acid responsive elements-binding factor 2 (.1.2.3) Potri.010G248100 [exp] 42 / 9e-06 AT3G56850 243 / 2e-79 ABA-responsive element binding protein 3 (.1) Potri.010G248300 [exp] 41 / 1e-05 AT3G56850 216 / 9e-69 ABA-responsive element binding protein 3 (.1) Potri.008G010800 [exp] 41 / 1e-05 AT3G56850 246 / 3e-80 ABA-responsive element binding protein 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0018 [flax] [poplar] bZIP PF00170 [flax] [poplar] bZIP_1 bZIP transcription factor
Representative CDS sequence Show only first row Show all	>Lus10042810 pacid=23181876 polypeptide=Lus10042810 locus=Lus10042810.g ID=Lus10042810.BGIv1.0 annot-version=v1.0 ATGATCAAGAATCGGGAGTCAGCTGCCAGGTCCAGGGAGAGGAAGCAGGCTTATCAAGTGGAACTGGAGTCCTTGGCAGTAAAGCTGGAGGAGGAGCATG AGCAACTGCTGAAAGAGAAGTTTCTGTTGAATCATGCAGCTTATGGAGAAAGTGATTCCTGTGGCGGAGAAGCGAAGACCGGTACGAATGCTGCGCAGAG TTTGCTCCTCGGTGTGGTAGATGATATCATGTAG
AA sequence Show only first row Show all	>Lus10042810 pacid=23181876 polypeptide=Lus10042810 locus=Lus10042810.g ID=Lus10042810.BGIv1.0 annot-version=v1.0 MIKNRESAARSRERKQAYQVELESLAVKLEEEHEQLLKEKFLLNHAAYGESDSCGGEAKTGTNAAQSLLLGVVDDIM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G03970	bZIP	GBF4	G-box binding factor 4 (.1)		Lus10042810 [exp]	0	1
AT5G16120			alpha/beta-Hydrolases superfam...		Lus10017601 [exp]	19.5	0.8417
AT5G38380			unknown protein		Lus10028477 [exp]	21.0	0.8127
AT2G38900			Serine protease inhibitor, pot...		Lus10035626 [exp]	22.0	0.8257
AT3G27340			unknown protein		Lus10022323 [exp]	25.6	0.8242
AT3G07530			unknown protein		Lus10040483 [exp]	28.7	0.8241
AT1G60800		NIK3	NSP-interacting kinase 3 (.1)		Lus10030591 [exp]	45.0	0.7609
AT3G14460			LRR and NB-ARC domains-contain...		Lus10039548 [exp]	66.3	0.8103
AT1G13570			F-box/RNI-like superfamily pro...		Lus10040760 [exp]	68.4	0.7961
AT3G58670			Protein of unknown function (D...		Lus10033603 [exp]	68.9	0.7927
AT3G07760			Sterile alpha motif (SAM) doma...		Lus10001743 [exp]	74.5	0.7773

Compare expression of checked genes

Lus10042810 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.