Lus10042819 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G49170 50 / 2e-08 Protein of unknown function (DUF167) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020853 91 / 2e-24 AT1G49170 107 / 2e-31 Protein of unknown function (DUF167) (.1)
Lus10033521 85 / 8e-22 AT1G49170 151 / 3e-48 Protein of unknown function (DUF167) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G056500 60 / 3e-12 AT1G49170 172 / 1e-56 Protein of unknown function (DUF167) (.1)
PFAM info
Representative CDS sequence
>Lus10042819 pacid=23181983 polypeptide=Lus10042819 locus=Lus10042819.g ID=Lus10042819.BGIv1.0 annot-version=v1.0
ATGGCTCCTTCAAGCAAGAAAGGTAAAGGAAAGGCGAACTCAGCTCCGTTGCAAAAATCAGAACCAAAACCTTCCTCCGACTTCCCCTCATGTATTCGAT
CGGTACCTCCGTCGTCAGTGGCCATCACCATCTACGCGAAGCCCGGCGCTAAATCGGCATCTATCACAGGTAGGATTTCGTGTTTTACTCTGATCTTCCT
CTCCGACGACGACCTGACCGCCGCTAGGACCCATCGTCACAAATCCAACCGGATGAAGATTCAGATCATAGTCCTCAATCCCTCTCCTAGTTCGATGGTG
ATGAAGATTGAGATCCGAATTCCACCTCTGTTACCGAACTTTCTCCCAACTCCGGTACTCCTCAGCAGCTCTTCAACTCCAGGCTCATCGGCAACGGATC
CAGGATGA
AA sequence
>Lus10042819 pacid=23181983 polypeptide=Lus10042819 locus=Lus10042819.g ID=Lus10042819.BGIv1.0 annot-version=v1.0
MAPSSKKGKGKANSAPLQKSEPKPSSDFPSCIRSVPPSSVAITIYAKPGAKSASITGRISCFTLIFLSDDDLTAARTHRHKSNRMKIQIIVLNPSPSSMV
MKIEIRIPPLLPNFLPTPVLLSSSSTPGSSATDPG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G49170 Protein of unknown function (D... Lus10042819 0 1
AT1G28250 unknown protein Lus10014006 2.8 0.8485
Lus10007802 5.3 0.8783
Lus10022051 7.5 0.7669
Lus10004778 8.6 0.8668
AT4G05400 copper ion binding (.1.2) Lus10031070 9.9 0.7733
Lus10014515 10.0 0.8537
AT3G51710 D-mannose binding lectin prote... Lus10009088 11.3 0.7934
AT5G44120 ATCRA1, CRU1, C... CRUCIFERINA, RmlC-like cupins ... Lus10024891 11.5 0.8512
Lus10042417 12.0 0.7938
AT2G31420 B3 Domain of unknown function (DU... Lus10039058 12.6 0.8377

Lus10042819 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.