Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042826 pacid=23182012 polypeptide=Lus10042826 locus=Lus10042826.g ID=Lus10042826.BGIv1.0 annot-version=v1.0 ATGGTTTATAATGTTGGGCTTTCCGGCCCTACCGGTACAACTTCAACCGCCACAGTCTCTGCCTCGCCGGCTTCGAATTCTGTTTCATCAGCAGCCACTA AGGAAGCTGAAGGGAGGTATGAACGTAGCTTGGTGTACTGGATGTTTGCTTATTTGGTCTTGTCCCAATTCCGATAA
AA sequence Show only first row Show all	>Lus10042826 pacid=23182012 polypeptide=Lus10042826 locus=Lus10042826.g ID=Lus10042826.BGIv1.0 annot-version=v1.0 MVYNVGLSGPTGTTSTATVSASPASNSVSSAATKEAEGRYERSLVYWMFAYLVLSQFR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10042826 [exp]	0	1
AT4G18340			Glycosyl hydrolase superfamily...		Lus10042825 [exp]	5.9	0.9046
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10026009 [exp]	8.3	0.8998
AT5G24620			Pathogenesis-related thaumatin...		Lus10015591 [exp]	11.5	0.9018
AT2G39830		LRD3, DAR2	LATERAL ROOT DEVELOPMENT 3, DA...		Lus10040258 [exp]	12.7	0.8728
AT1G29380			Carbohydrate-binding X8 domain...		Lus10004546 [exp]	13.4	0.8992
					Lus10009581 [exp]	14.3	0.8847
AT1G15170			MATE efflux family protein (.1...		Lus10029694 [exp]	16.9	0.8819
					Lus10020401 [exp]	17.1	0.8935
AT5G22870			Late embryogenesis abundant (L...		Lus10021404 [exp]	18.3	0.8924
AT4G27960		UBC9	ubiquitin conjugating enzyme 9...		Lus10005072 [exp]	18.3	0.8962

Compare expression of checked genes

Lus10042826 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.