Lus10042835 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18197 69 / 5e-14 PEX17, ATPUP7, AT4G18200 PEROXIN 17, ARABIDOPSIS THALIANA PURINE PERMEASE 7, purine permease 7 (.1)
AT4G18210 67 / 2e-13 ATPUP10 purine permease 10 (.1)
AT1G44750 64 / 1e-12 ATPUP11 purine permease 11 (.1.2.3)
AT4G18195 64 / 2e-12 ATPUP8, AT4G18200 ARABIDOPSIS THALIANA PURINE PERMEASE 8, purine permease 8 (.1)
AT4G18190 64 / 2e-12 ATPUP6 purine permease 6 (.1)
AT4G18220 62 / 6e-12 Drug/metabolite transporter superfamily protein (.1)
AT4G18205 62 / 1e-11 AT4G18200 Nucleotide-sugar transporter family protein (.1)
AT4G08700 59 / 1e-10 ATPUP13 Drug/metabolite transporter superfamily protein (.1)
AT5G41160 56 / 9e-10 ATPUP12 ARABIDOPSIS THALIANA PURINE PERMEASE 12, purine permease 12 (.1)
AT1G57980 40 / 0.0002 Nucleotide-sugar transporter family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028132 164 / 4e-49 AT4G18220 361 / 4e-123 Drug/metabolite transporter superfamily protein (.1)
Lus10030927 73 / 1e-15 AT4G18210 336 / 1e-113 purine permease 10 (.1)
Lus10040118 71 / 7e-15 AT4G18210 336 / 2e-113 purine permease 10 (.1)
Lus10019503 70 / 1e-14 AT1G44750 452 / 1e-159 purine permease 11 (.1.2.3)
Lus10026130 70 / 2e-14 AT4G18210 382 / 2e-131 purine permease 10 (.1)
Lus10008689 70 / 3e-14 AT4G18210 382 / 3e-131 purine permease 10 (.1)
Lus10043350 69 / 6e-14 AT1G44750 456 / 8e-161 purine permease 11 (.1.2.3)
Lus10023318 66 / 2e-13 AT4G18210 159 / 9e-47 purine permease 10 (.1)
Lus10038492 65 / 8e-13 AT4G18210 344 / 3e-116 purine permease 10 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G352200 84 / 2e-19 AT4G18220 315 / 1e-105 Drug/metabolite transporter superfamily protein (.1)
Potri.001G147600 77 / 7e-17 AT4G18210 315 / 7e-105 purine permease 10 (.1)
Potri.001G352100 75 / 4e-16 AT4G18210 398 / 1e-137 purine permease 10 (.1)
Potri.014G043900 68 / 9e-14 AT1G44750 434 / 2e-152 purine permease 11 (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10042835 pacid=23181728 polypeptide=Lus10042835 locus=Lus10042835.g ID=Lus10042835.BGIv1.0 annot-version=v1.0
ATGGGAGAAGCTCAAGAGCAGGCAGCCTTCAAAACCCATGCTATGGGCCTCGAGAATCAATCCGGCGTCGTTCCGAGGAGCGAGCAGGGAACAGCGTGGT
GGGTTCGAGTAGGGGTTTACTCGATACTGGTTCTGGCAGGGCAGTCAGCGGCGACATTGCTCGGAAGGGTGTACTACGACAAAGGTGGGAGCAGTAAATG
GATGGCAACCCTCATTGAATCAGCCGCTTTCCCAATCCTACTCCCACTCTACTTCCTCCGACTCCGACGACGACGAACCAACAACAACAATGAAACGACC
CAAAGACATTCAATTCTTGTTTCCCTTCCATTCCTAACCTTGGCTTACTTCGCATTCGGGCTACTAACCGCCGCCTTCAGACTACTCCACGTCGCAGGCT
CCACACACGTCCCGTACCCCACCCAATCGTCCCAATCGGTTTCATCTGTACGGTCGTGGCATCGGCGGGGTACGGACTACTGCTGTCGTTAA
AA sequence
>Lus10042835 pacid=23181728 polypeptide=Lus10042835 locus=Lus10042835.g ID=Lus10042835.BGIv1.0 annot-version=v1.0
MGEAQEQAAFKTHAMGLENQSGVVPRSEQGTAWWVRVGVYSILVLAGQSAATLLGRVYYDKGGSSKWMATLIESAAFPILLPLYFLRLRRRRTNNNNETT
QRHSILVSLPFLTLAYFAFGLLTAAFRLLHVAGSTHVPYPTQSSQSVSSVRSWHRRGTDYCCR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18210 ATPUP10 purine permease 10 (.1) Lus10042835 0 1
AT3G05480 ATRAD9 cell cycle checkpoint control ... Lus10029894 1.4 0.9038
Lus10029057 1.4 0.9095
AT3G54200 Late embryogenesis abundant (L... Lus10018361 10.2 0.8752
AT1G50270 Pentatricopeptide repeat (PPR)... Lus10017351 12.2 0.8462
AT3G54140 ATPTR1 ARABIDOPSIS THALIANA PEPTIDE T... Lus10021132 13.0 0.8605
AT3G63480 ATP binding microtubule motor ... Lus10035344 13.4 0.8886
AT3G48540 Cytidine/deoxycytidylate deami... Lus10016755 15.2 0.8083
AT3G29575 AFP3 ABI five binding protein 3 (.1... Lus10003145 15.2 0.8582
AT2G42840 PDF1 protodermal factor 1 (.1) Lus10007352 17.1 0.9024
AT5G10530 Concanavalin A-like lectin pro... Lus10007077 21.2 0.8535

Lus10042835 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.