Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 112 / 8e-32 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 110 / 7e-31 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G08685 92 / 3e-24 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 84 / 1e-20 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT5G10130 64 / 5e-13 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G15780 45 / 5e-06 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G05500 43 / 2e-05 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028134 [exp] 331 / 2e-118 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017940 [exp] 209 / 4e-70 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10018131 [exp] 209 / 6e-70 AT1G29140 118 / 5e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 207 / 5e-69 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 116 / 2e-33 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013908 [exp] 119 / 4e-32 AT2G42590 400 / 1e-139 general regulatory factor 9 (.1.2.3) Lus10042201 [exp] 103 / 1e-28 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 99 / 2e-26 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10026040 [exp] 89 / 7e-23 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G111300 [exp] 170 / 8e-55 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 159 / 3e-50 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G167900 [exp] 108 / 2e-30 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 105 / 3e-29 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G078200 [exp] 100 / 3e-27 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 99 / 1e-26 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 45 / 8e-06 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 44 / 1e-05 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 41 / 0.0002 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.010G185400 [exp] 40 / 0.0002 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10042838 pacid=23181753 polypeptide=Lus10042838 locus=Lus10042838.g ID=Lus10042838.BGIv1.0 annot-version=v1.0 ATGGGGAAAATTGGTGTAGTGAGCCTCATCCTTTTGGGCACCGCGCTGTTCATTTTAAGAACCGTCGATGCCGATAGTAAGATGTTTGTGGAAGGAAAGG TGTATTGTGATCCTTGCCGTGTCGAATTTCCGGTTAAAATCAGCACAATGATGCCAGGGGCGAGGGTGAGCTTGGAATGTCTAAGCAGGGAGAATAACAC AGTCACGTACAAAGTCGAAGGAGAAACAGACAAGACCGGCACGTACAAACTACCAGTAATAGCAAATCACGAAGAAGATCTGTGCGATGTAAAGTTGCTT AAGAGCCCAAGAGACGATTGCAAGGAGAAGTTCAGGTTCATCGACAAGGCAAGAGTTCTCCTCACAAACAACATGGGTGTGGTTCAGCCTATTTGCTACG CCAACCCGATTGGGTTCATGACCACCACCACCGACCCTCGTTGCGAGAAACTCATGCAAGAAATGGGCATCACTCTTCAAGAGGCCCAAACCAAGATCCC ATAA
AA sequence Show only first row Show all	>Lus10042838 pacid=23181753 polypeptide=Lus10042838 locus=Lus10042838.g ID=Lus10042838.BGIv1.0 annot-version=v1.0 MGKIGVVSLILLGTALFILRTVDADSKMFVEGKVYCDPCRVEFPVKISTMMPGARVSLECLSRENNTVTYKVEGETDKTGTYKLPVIANHEEDLCDVKLL KSPRDDCKEKFRFIDKARVLLTNNMGVVQPICYANPIGFMTTTTDPRCEKLMQEMGITLQEAQTKIP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29140			Pollen Ole e 1 allergen and ex...		Lus10042838 [exp]	0	1
AT3G47570			Leucine-rich repeat protein ki...		Lus10037955 [exp]	2.0	0.7190
					Lus10016963 [exp]	3.0	0.7342
AT5G07400	FHA		forkhead-associated domain-con...		Lus10043015 [exp]	4.5	0.7013
AT3G21120			F-box and associated interacti...		Lus10040800 [exp]	13.0	0.6809
AT1G68460		ATIPT1	Arabidopsis thaliana isopenten...		Lus10034334 [exp]	20.1	0.6419
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10024367 [exp]	27.9	0.6116
AT1G69490	NAC	NAP, ANAC029, A...	Arabidopsis NAC domain contain...		Lus10036773 [exp]	30.0	0.7045
AT4G08570			Heavy metal transport/detoxifi...		Lus10039419 [exp]	33.0	0.6840
AT1G17800		AtENODL22	early nodulin-like protein 22 ...		Lus10020984 [exp]	33.7	0.6306
AT3G17770			Dihydroxyacetone kinase (.1)		Lus10031879 [exp]	41.9	0.6660

Compare expression of checked genes

Lus10042838 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.