Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60530 119 / 7e-33 GATA GATA4 GATA transcription factor 4 (.1) AT2G45050 91 / 7e-22 GATA GATA2 GATA transcription factor 2 (.1) AT4G32890 89 / 8e-21 GATA GATA9 GATA transcription factor 9 (.1) AT5G25830 89 / 9e-21 GATA GATA12 GATA transcription factor 12 (.1) AT4G34680 84 / 4e-19 GATA GATA3 GATA transcription factor 3 (.1.2) AT1G08010 79 / 2e-17 GATA GATA11 GATA transcription factor 11 (.1.2) AT3G24050 78 / 5e-17 GATA GATA1 GATA transcription factor 1 (.1) AT4G36240 77 / 6e-17 GATA GATA7 GATA transcription factor 7 (.1) AT3G54810 77 / 2e-16 GATA GATA8, BME3, BME3-ZF GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) AT1G08000 75 / 1e-15 GATA GATA10 GATA transcription factor 10 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028178 [exp] 214 / 1e-69 AT2G45050 204 / 3e-65 GATA transcription factor 2 (.1) Lus10037572 [exp] 100 / 3e-25 AT4G32890 236 / 2e-76 GATA transcription factor 9 (.1) Lus10011430 [exp] 91 / 2e-21 AT4G32890 237 / 9e-77 GATA transcription factor 9 (.1) Lus10025829 [exp] 87 / 5e-20 AT4G32890 221 / 2e-70 GATA transcription factor 9 (.1) Lus10038273 [exp] 86 / 8e-20 AT4G32890 219 / 1e-69 GATA transcription factor 9 (.1) Lus10023684 [exp] 80 / 3e-18 AT3G24050 168 / 3e-52 GATA transcription factor 1 (.1) Lus10011762 [exp] 77 / 9e-17 AT3G24050 174 / 1e-53 GATA transcription factor 1 (.1) Lus10009227 [exp] 77 / 3e-16 AT3G54810 162 / 8e-47 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Lus10037994 [exp] 77 / 3e-16 AT3G54810 160 / 6e-46 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G058600 [exp] 125 / 3e-35 AT3G60530 189 / 7e-60 GATA transcription factor 4 (.1) Potri.002G142800 [exp] 124 / 6e-35 AT3G60530 189 / 1e-59 GATA transcription factor 4 (.1) Potri.001G188500 [exp] 85 / 3e-19 AT4G32890 201 / 7e-63 GATA transcription factor 9 (.1) Potri.006G237700 [exp] 85 / 5e-19 AT5G25830 246 / 2e-79 GATA transcription factor 12 (.1) Potri.018G044900 [exp] 84 / 6e-19 AT5G25830 247 / 2e-79 GATA transcription factor 12 (.1) Potri.010G223300 [exp] 82 / 5e-18 AT3G54810 148 / 8e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.008G038900 [exp] 82 / 6e-18 AT3G54810 150 / 1e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.013G059600 [exp] 79 / 4e-17 AT5G25830 128 / 1e-34 GATA transcription factor 12 (.1) Potri.019G033000 [exp] 77 / 2e-16 AT4G32890 127 / 2e-34 GATA transcription factor 9 (.1) Potri.009G123400 [exp] 77 / 2e-16 AT5G66320 179 / 8e-54 GATA transcription factor 5 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00320 [flax] [poplar] GATA GATA zinc finger
Representative CDS sequence Show only first row Show all	>Lus10042879 pacid=23181891 polypeptide=Lus10042879 locus=Lus10042879.g ID=Lus10042879.BGIv1.0 annot-version=v1.0 ATGGACGTTTATGGCTCCATCAATCCTTCTTCCGATTCCTTCAACTTCCCAATCGACGATCTCCTCGACTTCTCCAGCGATGGTCTCTTCTCCTCCACCA CCACCTCTTCCTCCACCGCCTCCACCCCCGACCACCTCCCCTCCCTTCCTTCCTTCCACCACCACCATTCATCCTCCTTTCACCTCGCTGCCCCTGATTT CACCCCTGACTACTTTGCTCATCAGCTCTCCCTTCCGAACGATGACGTGGCTGAGCTGGAATGGCTGTCTCAATTCGTTGACGATTCCTTCGCCGACTTC CCTCCCAACTCACTCGCGGTCGTCCAATCAACCGCCGCGGCCGTCTCATCCTCCTCCTCATTCTCCTTCTCCTCTGCCAGCAGAGGCAGAGCGGCCCGCA GCAAGCGATCTAGACTACCAGCAGTCAACGGCGGCGGCGCTGCGGCGTGGAAGGTGGAAGGAGGGGTTAGCAGCAGGGCATCGTCGCCGACACCGGAGGG AGGAGTGAGGCGGTGCACGCACTGCGCGTCTGAGAAGACGCCGCAGTGGAGGACGGGTCCGATGGGGCCAAAAACTCTGTGCAATGCGTGTGGGGTGAGG TACAAGTCCGGGAGGCTGACCGAGAATTGCAGAGGAGTTGATTGTGATGGGGTTAGAGAGCGAAAATCTAATTCGGAGAATTACTAG
AA sequence Show only first row Show all	>Lus10042879 pacid=23181891 polypeptide=Lus10042879 locus=Lus10042879.g ID=Lus10042879.BGIv1.0 annot-version=v1.0 MDVYGSINPSSDSFNFPIDDLLDFSSDGLFSSTTTSSSTASTPDHLPSLPSFHHHHSSSFHLAAPDFTPDYFAHQLSLPNDDVAELEWLSQFVDDSFADF PPNSLAVVQSTAAAVSSSSSFSFSSASRGRAARSKRSRLPAVNGGGAAAWKVEGGVSSRASSPTPEGGVRRCTHCASEKTPQWRTGPMGPKTLCNACGVR YKSGRLTENCRGVDCDGVRERKSNSENY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45050	GATA	GATA2	GATA transcription factor 2 (....		Lus10042879 [exp]	0	1
AT1G23170			Protein of unknown function DU...		Lus10034590 [exp]	1.0	0.8237
AT4G34810			SAUR-like auxin-responsive pro...		Lus10042377 [exp]	3.5	0.7818
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Lus10014731 [exp]	18.7	0.7967
AT1G76880	Trihelix		Duplicated homeodomain-like su...		Lus10028582 [exp]	23.2	0.8104
AT1G76190			SAUR-like auxin-responsive pro...		Lus10034570 [exp]	23.6	0.7987
AT4G01650			Polyketide cyclase / dehydrase...		Lus10007203 [exp]	25.8	0.7951
AT5G62350			Plant invertase/pectin methyle...		Lus10027198 [exp]	31.7	0.7650
AT3G62980		AtTIR1, TIR1	TRANSPORT INHIBITOR RESPONSE 1...		Lus10011262 [exp]	39.5	0.7838
AT4G34810			SAUR-like auxin-responsive pro...		Lus10026294 [exp]	43.3	0.7935
AT5G38970		ATBR6OX, CYP85A...	brassinosteroid-6-oxidase 1 (....		Lus10005075 [exp]	54.2	0.7855

Compare expression of checked genes

Lus10042879 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.