Lus10042881 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G45040 180 / 9e-57 Matrixin family protein (.1)
AT4G16640 156 / 4e-47 Matrixin family protein (.1)
AT1G70170 130 / 3e-37 MMP matrix metalloproteinase (.1)
AT1G24140 127 / 1e-35 Matrixin family protein (.1)
AT1G59970 121 / 6e-34 Matrixin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028180 267 / 1e-91 AT2G45040 278 / 9e-93 Matrixin family protein (.1)
Lus10028955 170 / 2e-52 AT4G16640 360 / 3e-123 Matrixin family protein (.1)
Lus10004728 164 / 5e-50 AT4G16640 350 / 2e-119 Matrixin family protein (.1)
Lus10007478 158 / 9e-48 AT4G16640 345 / 2e-117 Matrixin family protein (.1)
Lus10030662 120 / 3e-33 AT1G59970 338 / 9e-115 Matrixin family protein (.1)
Lus10005605 88 / 1e-21 AT1G24140 223 / 9e-71 Matrixin family protein (.1)
Lus10032175 88 / 2e-21 AT1G59970 224 / 3e-71 Matrixin family protein (.1)
Lus10014512 88 / 2e-21 AT1G59970 221 / 6e-70 Matrixin family protein (.1)
Lus10041294 86 / 1e-20 AT1G59970 177 / 3e-53 Matrixin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G058200 181 / 9e-57 AT2G45040 358 / 3e-123 Matrixin family protein (.1)
Potri.001G157500 174 / 3e-54 AT2G45040 349 / 2e-119 Matrixin family protein (.1)
Potri.003G077400 167 / 1e-50 AT2G45040 330 / 1e-110 Matrixin family protein (.1)
Potri.015G103900 140 / 7e-41 AT1G24140 381 / 3e-131 Matrixin family protein (.1)
Potri.012G104600 140 / 7e-41 AT1G24140 393 / 5e-136 Matrixin family protein (.1)
Potri.013G100400 121 / 2e-34 AT1G59970 247 / 4e-80 Matrixin family protein (.1)
Potri.019G073700 108 / 3e-29 AT1G59970 213 / 7e-67 Matrixin family protein (.1)
Potri.019G073800 103 / 2e-27 AT1G70170 223 / 1e-70 matrix metalloproteinase (.1)
Potri.013G033200 103 / 2e-27 AT1G24140 246 / 2e-79 Matrixin family protein (.1)
Potri.019G073400 97 / 8e-25 AT1G70170 215 / 2e-67 matrix metalloproteinase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0126 Peptidase_MA PF00413 Peptidase_M10 Matrixin
Representative CDS sequence
>Lus10042881 pacid=23181885 polypeptide=Lus10042881 locus=Lus10042881.g ID=Lus10042881.BGIv1.0 annot-version=v1.0
ATGCAACTAGATTCCCCACGCGCAAAGCTGACGTACGCCTTCTCCCCTGAAAACACCATCGATTACCTGCCGCTATATTCCATCCGCGAAGCCTTCTGCC
GGGCTTTTCAGCGGTGGAGCTTGGTGATTCCGGTGAGCTTTACGGAGGAGGAGGACAACGGGTTCTCCGACGTCAAGATCGGGTTCTACAGCGGGGACCA
CGGCGACGGGGAGCCCCACTCTTTCTCGCCGGAGAGCGGGCGGCTCCACCTCGACGCGGCGGAGAGGTGGGCTTTTGATTTCGCGGTGGAGAAGTCAAAG
GTTGCCGTAGACTTGGAGTCCGTGGCGGTCCATGAGATACGACACGTGTTGTGGCTGGCCCACTCGGGGGATAAAGATGCGATTATGTATCCTAGCTTGA
AGCCCAGGAAGAGGAAAGTTGAGCTTAGCTTGACGATATAA
AA sequence
>Lus10042881 pacid=23181885 polypeptide=Lus10042881 locus=Lus10042881.g ID=Lus10042881.BGIv1.0 annot-version=v1.0
MQLDSPRAKLTYAFSPENTIDYLPLYSIREAFCRAFQRWSLVIPVSFTEEEDNGFSDVKIGFYSGDHGDGEPHSFSPESGRLHLDAAERWAFDFAVEKSK
VAVDLESVAVHEIRHVLWLAHSGDKDAIMYPSLKPRKRKVELSLTI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G45040 Matrixin family protein (.1) Lus10042881 0 1
AT1G07380 Neutral/alkaline non-lysosomal... Lus10001198 12.5 0.6526
AT1G72470 ATEXO70D1 exocyst subunit exo70 family p... Lus10001112 52.8 0.5020
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10011981 125.8 0.5457

Lus10042881 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.