Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57230 117 / 5e-34 MADS AGL16 AGAMOUS-like 16 (.1.2) AT2G14210 114 / 6e-33 MADS AGL44, ANR1 ARABIDOPSIS NITRATE REGULATED 1, AGAMOUS-like 44 (.1) AT4G37940 114 / 7e-33 MADS AGL21 AGAMOUS-like 21 (.1) AT2G22630 105 / 2e-29 MADS AGL17 AGAMOUS-like 17 (.1) AT3G57390 100 / 5e-27 MADS AGL18 AGAMOUS-like 18 (.1.2) AT2G45660 97 / 2e-26 MADS ATSOC1, SOC1, AGL20 SUPPRESSOR OF OVEREXPRESSION OF CO 1, AGAMOUS-like 20 (.1) AT5G15800 98 / 4e-26 MADS AGL2, SEP1 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) AT5G13790 98 / 5e-26 MADS AGL15 AGAMOUS-like 15 (.1) AT5G62165 96 / 1e-25 MADS FYF, AGL42 FOREVER YOUNG FLOWER, AGAMOUS-like 42 (.1.2.3.4.5) AT2G22540 96 / 1e-25 MADS AGL22, SVP SHORT VEGETATIVE PHASE, AGAMOUS-like 22, K-box region and MADS-box transcription factor family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028214 [exp] 119 / 7e-37 AT2G14210 117 / 1e-34 ARABIDOPSIS NITRATE REGULATED 1, AGAMOUS-like 44 (.1) Lus10029556 [exp] 108 / 1e-31 AT3G57230 104 / 7e-29 AGAMOUS-like 16 (.1.2) Lus10020477 [exp] 103 / 2e-29 AT4G37940 195 / 4e-64 AGAMOUS-like 21 (.1) Lus10005325 [exp] 102 / 1e-27 AT5G13790 249 / 7e-83 AGAMOUS-like 15 (.1) Lus10039580 [exp] 101 / 2e-27 AT5G13790 246 / 2e-81 AGAMOUS-like 15 (.1) Lus10007100 [exp] 100 / 3e-27 AT3G57230 226 / 4e-75 AGAMOUS-like 16 (.1.2) Lus10025719 [exp] 99 / 3e-27 AT2G22540 286 / 4e-99 SHORT VEGETATIVE PHASE, AGAMOUS-like 22, K-box region and MADS-box transcription factor family protein (.1.2) Lus10031665 [exp] 96 / 3e-26 AT5G62165 179 / 8e-58 FOREVER YOUNG FLOWER, AGAMOUS-like 42 (.1.2.3.4.5) Lus10036543 [exp] 93 / 3e-26 AT2G45660 120 / 6e-36 SUPPRESSOR OF OVEREXPRESSION OF CO 1, AGAMOUS-like 20 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G109601 [exp] 120 / 2e-35 AT3G57230 299 / 1e-103 AGAMOUS-like 16 (.1.2) Potri.009G079000 [exp] 115 / 3e-33 AT4G37940 293 / 3e-101 AGAMOUS-like 21 (.1) Potri.005G150501 [exp] 115 / 1e-32 AT3G57230 322 / 8e-112 AGAMOUS-like 16 (.1.2) Potri.001G284600 [exp] 112 / 7e-32 AT4G37940 272 / 7e-93 AGAMOUS-like 21 (.1) Potri.001G284301 [exp] 112 / 7e-32 AT4G37940 272 / 7e-93 AGAMOUS-like 21 (.1) Potri.006G048700 [exp] 107 / 6e-30 AT3G57390 219 / 2e-71 AGAMOUS-like 18 (.1.2) Potri.009G055700 [exp] 101 / 2e-27 AT5G13790 241 / 9e-80 AGAMOUS-like 15 (.1) Potri.012G132600 [exp] 97 / 5e-26 AT2G45650 182 / 3e-57 AGAMOUS-like 6 (.1) Potri.003G119700 [exp] 96 / 7e-26 AT4G11880 226 / 4e-75 AGAMOUS-like 14 (.1) Potri.002G151700 [exp] 96 / 8e-26 AT2G45660 212 / 8e-70 SUPPRESSOR OF OVEREXPRESSION OF CO 1, AGAMOUS-like 20 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00319 [flax] [poplar] SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain)
Representative CDS sequence Show only first row Show all	>Lus10042918 pacid=23181756 polypeptide=Lus10042918 locus=Lus10042918.g ID=Lus10042918.BGIv1.0 annot-version=v1.0 ATGGGGAGAGGGAAGATAGTGATAAGGAGGATAGACAATTCGACGAGTAGGCAAGTGACTTTCTCCAAGCGGAGGAACGGACTTCTCAAGAAGGCTAAGG AGTTGGCTATCCTTTGCGATGCCGATGTCGGAGTCATCATCTTCTCCAGCACCGGGAAACTCTACGATTTCTCCAGCTCCAGATTAATTGGTACTGCAAA CCGCAAGCTTTTCCTGGGTTGCGCAGTTGTTAGAGATCGTTGTGGCAAAGGTAGCAATGAATCTGAGAGAGAACAAATTAAGCTTGTGGAGATCAACTAC GTACCATGCGTACCTAGACTACGTGTATGTATGTGA
AA sequence Show only first row Show all	>Lus10042918 pacid=23181756 polypeptide=Lus10042918 locus=Lus10042918.g ID=Lus10042918.BGIv1.0 annot-version=v1.0 MGRGKIVIRRIDNSTSRQVTFSKRRNGLLKKAKELAILCDADVGVIIFSSTGKLYDFSSSRLIGTANRKLFLGCAVVRDRCGKGSNESEREQIKLVEINY VPCVPRLRVCM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G57230	MADS	AGL16	AGAMOUS-like 16 (.1.2)		Lus10042918 [exp]	0	1
AT3G19200			unknown protein		Lus10014046 [exp]	32.1	0.8056
AT4G35783		RTFL6, DVL17	DEVIL 17, ROTUNDIFOLIA like 6 ...		Lus10041846 [exp]	71.2	0.7870
AT5G48130			Phototropic-responsive NPH3 fa...		Lus10001738 [exp]	87.5	0.7750
AT2G17820		AHK1, ATHK1	histidine kinase 1 (.1)		Lus10041891 [exp]	102.6	0.7783
AT4G09890			Protein of unknown function (D...		Lus10033529 [exp]	117.5	0.7718
AT5G63180			Pectin lyase-like superfamily ...		Lus10014887 [exp]	153.0	0.7520
AT1G50680	AP2_ERF		AP2/B3 transcription factor fa...		Lus10021848 [exp]	249.9	0.7316
AT2G26730			Leucine-rich repeat protein ki...		Lus10014525 [exp]	255.0	0.7297

Compare expression of checked genes

Lus10042918 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.