Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31970 53 / 8e-10 CYP82C2, JAH1 "cytochrome P450, family 82, subfamily C, polypeptide 2", cytochrome P450, family 82, subfamily C, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028217 [exp] 133 / 8e-40 AT4G31970 292 / 2e-95 "cytochrome P450, family 82, subfamily C, polypeptide 2", cytochrome P450, family 82, subfamily C, polypeptide 2 (.1) Lus10010758 [exp] 130 / 8e-38 AT4G31970 346 / 1e-114 "cytochrome P450, family 82, subfamily C, polypeptide 2", cytochrome P450, family 82, subfamily C, polypeptide 2 (.1) Lus10035635 [exp] 127 / 5e-36 AT4G31940 470 / 8e-162 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10011657 [exp] 112 / 2e-30 AT4G31940 479 / 3e-160 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10032743 [exp] 105 / 3e-28 AT4G31940 460 / 1e-157 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10011658 [exp] 67 / 1e-14 AT4G31940 510 / 9e-178 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10007837 [exp] 54 / 4e-10 AT4G31940 575 / 0.0 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10032745 [exp] 53 / 1e-09 AT4G31940 571 / 0.0 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10038203 [exp] 52 / 2e-09 AT3G25180 495 / 9e-172 cytochrome P450, family 82, subfamily G, polypeptide 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G037400 [exp] 79 / 1e-18 AT4G31940 476 / 4e-164 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.014G037700 [exp] 76 / 1e-17 AT4G31940 508 / 1e-176 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.014G037800 [exp] 76 / 1e-17 AT4G31940 495 / 9e-172 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.014G037600 [exp] 74 / 3e-17 AT4G31940 478 / 7e-165 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.014G038200 [exp] 68 / 4e-15 AT4G31940 501 / 7e-174 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.014G038100 [exp] 68 / 7e-15 AT4G31940 520 / 0.0 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.014G038000 [exp] 67 / 1e-14 AT4G31940 514 / 5e-179 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.014G037900 [exp] 63 / 2e-13 AT4G31970 481 / 2e-166 "cytochrome P450, family 82, subfamily C, polypeptide 2", cytochrome P450, family 82, subfamily C, polypeptide 2 (.1) Potri.014G037500 [exp] 63 / 4e-13 AT4G31940 717 / 0.0 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Potri.016G008500 [exp] 47 / 1e-07 AT4G31940 499 / 2e-173 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042921 pacid=23181939 polypeptide=Lus10042921 locus=Lus10042921.g ID=Lus10042921.BGIv1.0 annot-version=v1.0 ATGGTGGACATGACCACCTGGTTTGGGGACATTGCGTTGAACGTTATACTGACGATGATCGTAGGGACATCTATCGGGTACTTGAAGCGAGGAGACTACG GCATTAGACTGAAGAAAGTGTTGAATAGTTTCTTCGAACTTTCCGGAAGGTTCGTGGTGGCGGACGGTGTTCCTTGTCTGAGGTGGTTGGACGTGGGAGG ATTCGAGAAGGCAATGAGGAAGACACTGTTGGGGCGCTAG
AA sequence Show only first row Show all	>Lus10042921 pacid=23181939 polypeptide=Lus10042921 locus=Lus10042921.g ID=Lus10042921.BGIv1.0 annot-version=v1.0 MVDMTTWFGDIALNVILTMIVGTSIGYLKRGDYGIRLKKVLNSFFELSGRFVVADGVPCLRWLDVGGFEKAMRKTLLGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31950		CYP82C3	"cytochrome P450, family 82, s...		Lus10042921 [exp]	0	1
AT3G55120		A11, CFI, TT5	TRANSPARENT TESTA 5, CHALCONE ...		Lus10030310 [exp]	1.0	0.8395
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10042922 [exp]	1.4	0.8341
AT1G58340		BCD1, ZRZ, ZF14	ZRIZI, BUSH-AND-CHLOROTIC-DWAR...		Lus10028230 [exp]	2.8	0.7815
AT1G78230			Outer arm dynein light chain 1...		Lus10033444 [exp]	7.0	0.7836
AT5G19340			unknown protein		Lus10010529 [exp]	7.7	0.8174
AT3G10720			Plant invertase/pectin methyle...		Lus10008937 [exp]	8.3	0.8257
AT4G10310		ATHKT1, HKT1	high-affinity K+ transporter 1...		Lus10026948 [exp]	8.5	0.7914
AT5G40150			Peroxidase superfamily protein...		Lus10032170 [exp]	9.7	0.8109
AT3G43270			Plant invertase/pectin methyle...		Lus10017375 [exp]	15.6	0.7759
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10008936 [exp]	16.7	0.7740

Compare expression of checked genes

Lus10042921 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.