Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G65660 65 / 2e-14 hydroxyproline-rich glycoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028220 [exp] 137 / 6e-43 AT5G65660 100 / 3e-28 hydroxyproline-rich glycoprotein family protein (.1) Lus10032818 [exp] 83 / 9e-22 AT5G65660 84 / 7e-22 hydroxyproline-rich glycoprotein family protein (.1) Lus10028221 [exp] 82 / 3e-21 AT5G65660 66 / 1e-14 hydroxyproline-rich glycoprotein family protein (.1) Lus10042928 [exp] 63 / 7e-14 AT5G65660 66 / 8e-15 hydroxyproline-rich glycoprotein family protein (.1) Lus10039633 [exp] 62 / 3e-13 AT5G65660 147 / 1e-46 hydroxyproline-rich glycoprotein family protein (.1) Lus10002158 [exp] 62 / 5e-13 AT5G65660 146 / 3e-46 hydroxyproline-rich glycoprotein family protein (.1) Lus10019240 [exp] 46 / 1e-06 AT5G10560 407 / 1e-133 Glycosyl hydrolase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G108100 [exp] 81 / 6e-21 AT5G65660 95 / 6e-26 hydroxyproline-rich glycoprotein family protein (.1) Potri.019G055500 [exp] 62 / 3e-13 AT5G65660 114 / 2e-33 hydroxyproline-rich glycoprotein family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042927 pacid=23181784 polypeptide=Lus10042927 locus=Lus10042927.g ID=Lus10042927.BGIv1.0 annot-version=v1.0 ATGGAGGACGATGATCGCCCCATCATCGGCTTCCCTCTCGGATTTGCTCTTTTACTGCTCACTCTCATCACCATGAGTGCCGTCTTCATCTGCTGCCTTC ACTGGGATCGCCTCCGTTCCTGTTGGGACGTTACTCCTACTACTGATCATGATCATGATCATGATGAAATCCACCATAAATCATCGCCTCCACAACTGAA AATGGGCAAGATGATGAGGGAGAGCCTGCCGGTGTTGATGCCAGGAGATCAATTGCCAAGGTTCGTGGCCATGGCTTGTCCCTGCGAGAAGCCGATTCTA GTAGACACGATTCAAGTTGAAGATCAGAAGCCGCCGGCCACTCTGTTTCCTGTCCCTCCTCTGTTTTAG
AA sequence Show only first row Show all	>Lus10042927 pacid=23181784 polypeptide=Lus10042927 locus=Lus10042927.g ID=Lus10042927.BGIv1.0 annot-version=v1.0 MEDDDRPIIGFPLGFALLLLTLITMSAVFICCLHWDRLRSCWDVTPTTDHDHDHDEIHHKSSPPQLKMGKMMRESLPVLMPGDQLPRFVAMACPCEKPIL VDTIQVEDQKPPATLFPVPPLF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G65660			hydroxyproline-rich glycoprote...		Lus10042927 [exp]	0	1
AT3G10120			unknown protein		Lus10021358 [exp]	2.0	0.8687
AT1G05160		ATKAO1, CYP88A3	ENT-KAURENOIC ACID OXYDASE 1, ...		Lus10033105 [exp]	4.5	0.8508
AT1G23390			Kelch repeat-containing F-box ...		Lus10029128 [exp]	4.8	0.8718
AT2G25620		AtDBP1	DNA-binding protein phosphatas...		Lus10001682 [exp]	7.1	0.8609
AT1G21550			Calcium-binding EF-hand family...		Lus10028657 [exp]	8.9	0.8266
AT1G35830			VQ motif-containing protein (....		Lus10024738 [exp]	9.0	0.8686
AT5G02090			unknown protein		Lus10024357 [exp]	10.2	0.8563
AT5G15870			glycosyl hydrolase family 81 p...		Lus10021987 [exp]	11.0	0.8440
					Lus10004020 [exp]	15.3	0.7484
AT3G47510			unknown protein		Lus10019094 [exp]	15.9	0.8082

Compare expression of checked genes

Lus10042927 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.