Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G71050 196 / 3e-65 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 188 / 2e-62 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 174 / 1e-56 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT4G38580 162 / 7e-52 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT5G66110 156 / 9e-50 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT4G39700 149 / 9e-47 Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 137 / 3e-42 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 134 / 7e-41 Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 97 / 4e-26 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 89 / 7e-23 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032446 [exp] 289 / 1e-101 AT1G71050 175 / 2e-56 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 244 / 2e-84 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 243 / 4e-84 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10028531 [exp] 197 / 8e-66 AT5G17450 207 / 1e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10009115 [exp] 197 / 2e-65 AT5G17450 206 / 5e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10019676 [exp] 185 / 7e-61 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 183 / 3e-60 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10028426 [exp] 166 / 2e-53 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10041879 [exp] 166 / 2e-53 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G114600 [exp] 236 / 4e-81 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 202 / 9e-68 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.007G087300 [exp] 170 / 5e-55 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 164 / 7e-53 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 164 / 1e-52 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 164 / 2e-52 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G175400 [exp] 163 / 2e-52 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.009G135300 [exp] 158 / 2e-50 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G110400 [exp] 158 / 2e-50 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 145 / 2e-45 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10042946 pacid=23167925 polypeptide=Lus10042946 locus=Lus10042946.g ID=Lus10042946.BGIv1.0 annot-version=v1.0 ATGGGGGCTCTGGACTCTGTTTCAGACTACTTGTCAGAGTTATTTAGAATCGCCAAGAACAAGAGGAAGCGCAAGCAAATGGCGACGGTAGAGATCAAAG TAAAAATGGACTGCGATGGATGCGAGAGGAAAGTCAAGAATTCTGTTAAGCACATGAAAGGGGTGAAATCAGTGGAGCTGAGCAGAAAACAGAGCAGGCT AACGGTGAAGGGATACGTGGAACCGAAGAAGGTGTTGAAGAGGGTTACAAACACAGGGAAGAAGGCAGAGTTTTGGCCCTACGTTCAGTACAATCTTGTC AGTTATCCTTACGTCGCCGGAGCTTATGACAAGAAGGCTCCCTCCGGTTACGTCAGAAACGTCCCGCAAGCCCTTCCCAGCTCCTCCGACACCGGCGAGA CCTTGACTTCCTTGTTCAGCGACGACAACCCAAATGCCTGCTCCGTTATGTAG
AA sequence Show only first row Show all	>Lus10042946 pacid=23167925 polypeptide=Lus10042946 locus=Lus10042946.g ID=Lus10042946.BGIv1.0 annot-version=v1.0 MGALDSVSDYLSELFRIAKNKRKRKQMATVEIKVKMDCDGCERKVKNSVKHMKGVKSVELSRKQSRLTVKGYVEPKKVLKRVTNTGKKAEFWPYVQYNLV SYPYVAGAYDKKAPSGYVRNVPQALPSSSDTGETLTSLFSDDNPNACSVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G71050		HIPP20	heavy metal associated isopren...		Lus10042946 [exp]	0	1
					Lus10015218 [exp]	1.7	0.9449
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039501 [exp]	2.8	0.9614
AT2G29640		JOSL	JOSEPHIN-like protein (.1)		Lus10040691 [exp]	3.2	0.9369
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039502 [exp]	4.2	0.9502
AT5G18190			Protein kinase family protein ...		Lus10043244 [exp]	5.3	0.9449
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Lus10000546 [exp]	5.5	0.9150
					Lus10033730 [exp]	6.3	0.8889
AT1G71050		HIPP20	heavy metal associated isopren...		Lus10032446 [exp]	6.5	0.8838
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Lus10038807 [exp]	6.6	0.7810
AT3G12620			Protein phosphatase 2C family ...		Lus10003993 [exp]	7.1	0.8972

Compare expression of checked genes

Lus10042946 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.