Lus10042957 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18570 119 / 2e-34 Oleosin family protein (.1)
AT1G48990 98 / 6e-26 Oleosin family protein (.1)
AT2G25890 71 / 1e-15 Oleosin family protein (.1)
AT4G25140 67 / 4e-14 OLE1, OLEO1 oleosin 1 (.1)
AT3G27660 53 / 6e-09 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1)
AT5G51210 52 / 6e-09 OLEO3 oleosin3 (.1)
AT5G40420 53 / 7e-09 OLE2, PA23, OLEO2 oleosin 2 (.1)
AT3G01570 47 / 8e-07 Oleosin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032461 297 / 3e-104 AT3G18570 142 / 1e-43 Oleosin family protein (.1)
Lus10017992 152 / 3e-47 AT3G18570 136 / 4e-41 Oleosin family protein (.1)
Lus10041987 147 / 5e-45 AT3G18570 129 / 2e-38 Oleosin family protein (.1)
Lus10027161 79 / 8e-19 AT4G25140 154 / 3e-48 oleosin 1 (.1)
Lus10039683 77 / 6e-18 AT4G25140 159 / 2e-50 oleosin 1 (.1)
Lus10031387 74 / 5e-17 AT4G25140 164 / 1e-52 oleosin 1 (.1)
Lus10010943 76 / 4e-16 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10017460 72 / 6e-16 AT4G25140 136 / 9e-42 oleosin 1 (.1)
Lus10028822 70 / 2e-15 AT4G25140 146 / 3e-46 oleosin 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G059400 135 / 8e-41 AT3G18570 113 / 4e-32 Oleosin family protein (.1)
Potri.006G234900 89 / 8e-23 AT2G25890 113 / 1e-32 Oleosin family protein (.1)
Potri.018G057800 76 / 9e-18 AT2G25890 91 / 5e-24 Oleosin family protein (.1)
Potri.001G080000 73 / 7e-17 AT4G25140 108 / 1e-30 oleosin 1 (.1)
Potri.003G150600 66 / 5e-14 AT4G25140 124 / 3e-37 oleosin 1 (.1)
Potri.015G081901 53 / 5e-09 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.T125308 53 / 5e-09 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.012G083400 49 / 2e-07 AT5G40420 97 / 2e-25 oleosin 2 (.1)
Potri.017G071800 45 / 5e-06 AT3G01570 130 / 4e-39 Oleosin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01277 Oleosin Oleosin
Representative CDS sequence
>Lus10042957 pacid=23168023 polypeptide=Lus10042957 locus=Lus10042957.g ID=Lus10042957.BGIv1.0 annot-version=v1.0
ATGGCCGGCGAGTACAACGGGACAGGCGTCCCAAGGCCAACGAGACCAATCGCCGTCGTCGAAGCTGACAAAGACAACAGCAAAAGCACAACAACGACGA
CGACAACATTCCTCCGGAAAGCACAAAGCAGCTGGCGACAACACTACAACCCGCCGATTACGTCGACTCAGCTGGTGGGCCTTTTGACCCTCTTACTATC
GGGCACTATTCTGATCGTCTTCACGGGCCTGATAATCACAATGGCTATTCTCACCCTCATCTTCTTCGGTCCACTTCTGATCTTATCCAGCCCAATATGG
ATCCCTGTCGGCACGCTTCTCTTTGTCCTCGTCTCTGGCTTTCTAACGCTCTGCGGATGCTTCGTGGCGTTCGTCGCCGGTTTGGCGTGGACGTATAGGT
ATTTCAAAGGGATGAACCCGCCCGGATCGGATCAGGTGGATTACGCCCGGATCCGGATCTACGACACCGCTACCCATGTCAAGGATTGTGCCAAAGAATA
TGGTGGGTACCTGCAGAGCAAGGCCAAGGATGCCGCTCCTGGAGCGTAG
AA sequence
>Lus10042957 pacid=23168023 polypeptide=Lus10042957 locus=Lus10042957.g ID=Lus10042957.BGIv1.0 annot-version=v1.0
MAGEYNGTGVPRPTRPIAVVEADKDNSKSTTTTTTTFLRKAQSSWRQHYNPPITSTQLVGLLTLLLSGTILIVFTGLIITMAILTLIFFGPLLILSSPIW
IPVGTLLFVLVSGFLTLCGCFVAFVAGLAWTYRYFKGMNPPGSDQVDYARIRIYDTATHVKDCAKEYGGYLQSKAKDAAPGA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18570 Oleosin family protein (.1) Lus10042957 0 1
AT1G68040 S-adenosyl-L-methionine-depend... Lus10009675 2.4 0.7530
AT2G31420 B3 Domain of unknown function (DU... Lus10027287 14.8 0.6591
AT1G10200 LIM WLIM1, SF3 WLIM1, GATA type zinc finger t... Lus10027305 26.3 0.6668
AT5G38435 SPH8 S-protein homologue 8 (.1) Lus10029385 66.5 0.6933
AT1G74860 unknown protein Lus10033128 133.4 0.6379
AT1G71530 Protein kinase superfamily pro... Lus10009464 171.0 0.6109
Lus10011637 185.0 0.6109
AT3G12000 S-locus related protein SLR1, ... Lus10003420 195.1 0.6172
AT3G49000 RNA polymerase III subunit RPC... Lus10033989 196.8 0.6199
AT2G15480 UGT73B5 UDP-glucosyl transferase 73B5 ... Lus10026926 212.2 0.6263

Lus10042957 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.