Lus10042960 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G54640 162 / 1e-52 ATHTA1, HTA1, RAT5 RESISTANT TO AGROBACTERIUM TRANSFORMATION 5, histone H2A 1, Histone superfamily protein (.1)
AT1G51060 161 / 5e-52 HTA10 histone H2A 10 (.1)
AT4G27230 160 / 6e-52 HTA2 histone H2A 2 (.1.2)
AT3G20670 156 / 3e-50 HTA13 histone H2A 13 (.1)
AT1G54690 145 / 7e-46 HTA3 ,G-H2AX ,GAMMA-H2AX ,H2AXB histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1)
AT1G08880 145 / 2e-45 HTA5 ,G-H2AX ,GAMMA-H2AX ,H2AXA histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1)
AT5G59870 120 / 6e-36 HTA6 histone H2A 6 (.1)
AT5G02560 115 / 9e-34 HTA12 histone H2A 12 (.1.2)
AT5G27670 112 / 1e-32 HTA7 histone H2A 7 (.1)
AT1G52740 77 / 7e-19 HTA9 histone H2A protein 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032464 170 / 2e-55 AT1G51060 240 / 2e-83 histone H2A 10 (.1)
Lus10039691 145 / 7e-46 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1)
Lus10027154 145 / 7e-46 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1)
Lus10002253 142 / 3e-44 AT1G54690 244 / 9e-85 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1)
Lus10003750 137 / 3e-42 AT1G54690 239 / 7e-83 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1)
Lus10028044 134 / 2e-41 AT1G08880 238 / 4e-82 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1)
Lus10040853 119 / 6e-35 AT5G02560 228 / 4e-78 histone H2A 12 (.1.2)
Lus10005892 118 / 6e-35 AT5G02560 230 / 1e-78 histone H2A 12 (.1.2)
Lus10005444 118 / 7e-35 AT5G02560 234 / 2e-80 histone H2A 12 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G131400 164 / 3e-53 AT1G51060 200 / 1e-67 histone H2A 10 (.1)
Potri.001G415700 164 / 1e-52 AT1G51060 174 / 1e-56 histone H2A 10 (.1)
Potri.004G031300 152 / 8e-49 AT1G08880 150 / 6e-48 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1)
Potri.013G028900 143 / 1e-44 AT1G54690 220 / 4e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1)
Potri.005G040800 142 / 1e-44 AT1G54690 221 / 2e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1)
Potri.005G040700 137 / 2e-42 AT1G08880 183 / 2e-60 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1)
Potri.013G028800 134 / 4e-41 AT1G08880 190 / 2e-63 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1)
Potri.005G026500 120 / 1e-35 AT5G27670 145 / 2e-45 histone H2A 7 (.1)
Potri.013G018200 120 / 1e-35 AT5G27670 160 / 4e-51 histone H2A 7 (.1)
Potri.006G082300 118 / 5e-35 AT5G02560 143 / 2e-44 histone H2A 12 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10042960 pacid=23168279 polypeptide=Lus10042960 locus=Lus10042960.g ID=Lus10042960.BGIv1.0 annot-version=v1.0
ATGGCAGGTAGAGGGAAAACCCTAGGTTCCGGTGCCTCCAAGAAGGCAACCTCTAGAAGCAGCAAGGCCGGTCTGCAGTTCCCCGTCGGCCGTATCGCTA
GGTTCTTGAAGGCCGGCAAGTACGCCGAGCGTGTTGGTGCCGGCGCTCCTGTCTATCTCGCCGCCGTCCTTGAGTACCTCGCTGCTGAGGTTCTTGAATT
GGCCGGAAACGCAGCGAGAGATAACAAGAAGACAAGGATTGTGCCCCGCCACATCCAGCTAGCTGTGAGGAACGACGAGGAATTGAGCAAGCTTCTTGGA
GATGTGACGATTGCCAACGGTGGTGTGATGCCCAACATCCACAACCTTCTCCTCCCGAAAAAGGCCGGTGGCTCTGGATCGAAGGCTTCTGCTGACGATG
AGAGCTAA
AA sequence
>Lus10042960 pacid=23168279 polypeptide=Lus10042960 locus=Lus10042960.g ID=Lus10042960.BGIv1.0 annot-version=v1.0
MAGRGKTLGSGASKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLG
DVTIANGGVMPNIHNLLLPKKAGGSGSKASADDES

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G51060 HTA10 histone H2A 10 (.1) Lus10042960 0 1
AT3G58530 RNI-like superfamily protein (... Lus10012294 6.6 0.9177
AT3G13620 Amino acid permease family pro... Lus10010512 14.9 0.8944
AT1G51060 HTA10 histone H2A 10 (.1) Lus10032464 17.2 0.8976
AT2G45480 GRF ATGRF9 growth-regulating factor 9 (.1... Lus10009234 17.4 0.9111
AT3G63030 MBD4 methyl-CPG-binding domain 4 (.... Lus10008176 18.7 0.9109
AT3G18035 HON4 winged-helix DNA-binding trans... Lus10004328 19.6 0.8836
AT1G15660 CENP-C CENP-C HOMOLOGUE, centromere p... Lus10011470 20.5 0.8814
AT2G02540 ZF_HD ATHB21, ZFHD4, ... ZINC FINGER HOMEODOMAIN 3, ZIN... Lus10038135 22.2 0.9071
AT1G48620 HON5 high mobility group A5 (.1) Lus10032231 23.6 0.8247
AT5G07280 EXS, EMS1 EXTRA SPOROGENOUS CELLS, EXCES... Lus10014996 24.9 0.9022

Lus10042960 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.