Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018643 [exp] 57 / 2e-11 ND / Lus10029845 [exp] 44 / 2e-06 AT4G38080 40 / 6e-05 hydroxyproline-rich glycoprotein family protein (.1) Lus10018645 [exp] 39 / 0.0001 ND 35 / 0.004
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042963 pacid=23167965 polypeptide=Lus10042963 locus=Lus10042963.g ID=Lus10042963.BGIv1.0 annot-version=v1.0 ATGGCATCTTCCAAGTCCTTCTGCTTCTTCTTGGCCATCTCGCTCGCCGTCTCATTCTCCAACATGGATGCTACAACGGCGGCTCGCCAACTCTTCCAAG CCCCAACTCTGCCACAGCCAACTCTGCCTCAGCCAACTCCGCCGATGCTAACTCTGCCGATGACGACTCTCCCTACCACCAGACTGTCGTCGATCCCCGC TGCCGGCGCCATTCCAGCGATTCCTGTGTCCATCCCGAAGCTTTCACTGCCGCCGGTGCCTGCCACCTTCCCGACGATCCCTTCGATTCCATTCACCATA CCTTCCATCTTTGACCTCTTTGCACCACCTCCTAGCAACTAG
AA sequence Show only first row Show all	>Lus10042963 pacid=23167965 polypeptide=Lus10042963 locus=Lus10042963.g ID=Lus10042963.BGIv1.0 annot-version=v1.0 MASSKSFCFFLAISLAVSFSNMDATTAARQLFQAPTLPQPTLPQPTPPMLTLPMTTLPTTRLSSIPAAGAIPAIPVSIPKLSLPPVPATFPTIPSIPFTI PSIFDLFAPPPSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10042963 [exp]	0	1
					Lus10024104 [exp]	1.0	0.9710
AT3G60720		PDLP8	plasmodesmata-located protein ...		Lus10036497 [exp]	2.0	0.9474
AT3G53720		ATCHX20	cation/H+ exchanger 20, cation...		Lus10025322 [exp]	3.7	0.9194
AT2G01660		PDLP6	plasmodesmata-located protein ...		Lus10016710 [exp]	5.2	0.9307
AT1G65480		FT	FLOWERING LOCUS T, PEBP (phosp...		Lus10004452 [exp]	7.7	0.9233
AT1G71890		SUC5, ATSUC5	SUCROSE-PROTON SYMPORTER 5, Ma...		Lus10014821 [exp]	9.9	0.9155
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10014773 [exp]	10.7	0.8992
AT4G27290			S-locus lectin protein kinase ...		Lus10016862 [exp]	11.6	0.9204
AT4G18340			Glycosyl hydrolase superfamily...		Lus10028122 [exp]	12.5	0.9199
AT2G23790			Protein of unknown function (D...		Lus10016305 [exp]	12.7	0.8995

Compare expression of checked genes

Lus10042963 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.