Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18510 56 / 2e-12 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032475 [exp] 90 / 1e-25 AT3G18510 80 / 8e-22 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G140300 [exp] 51 / 1e-10 AT3G18510 39 / 1e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042971 pacid=23168233 polypeptide=Lus10042971 locus=Lus10042971.g ID=Lus10042971.BGIv1.0 annot-version=v1.0 ATGGCGTTGGGTTCAAAGAAATGGGGTTATATGCGGATCATCACCGGAACAATCCTCGGCGGTGCTCTCGGGTTCTATGTTATGCACCGTATGGAGCTCA GCTACAAGGAGAAGACGAACGAGAGACTGAGGCAATACGAGATTGAGCTCAGGAAGAAAGAAGAAGAAGCCAATAATAATAAGCTCGACGAATCCCTTTA G
AA sequence Show only first row Show all	>Lus10042971 pacid=23168233 polypeptide=Lus10042971 locus=Lus10042971.g ID=Lus10042971.BGIv1.0 annot-version=v1.0 MALGSKKWGYMRIITGTILGGALGFYVMHRMELSYKEKTNERLRQYEIELRKKEEEANNNKLDESL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18510			unknown protein		Lus10042971 [exp]	0	1
AT3G18430			Calcium-binding EF-hand family...		Lus10010775 [exp]	1.7	0.8756
AT3G26350			unknown protein		Lus10011406 [exp]	3.0	0.8492
AT5G49010		EMB2812, SLD5	SYNTHETIC LETHALITY WITH DPB11...		Lus10033618 [exp]	4.2	0.8260
AT1G68220			Protein of unknown function (D...		Lus10043484 [exp]	5.0	0.8453
AT4G12590			Protein of unknown function DU...		Lus10027326 [exp]	6.0	0.8506
AT2G31490			unknown protein		Lus10027603 [exp]	6.9	0.8086
AT1G67170			unknown protein		Lus10019966 [exp]	10.2	0.8461
AT2G33845			Nucleic acid-binding, OB-fold-...		Lus10015411 [exp]	10.5	0.8134
AT2G04865			Aminotransferase-like, plant m...		Lus10007358 [exp]	12.4	0.8028
AT3G18510			unknown protein		Lus10032475 [exp]	12.7	0.8240

Compare expression of checked genes

Lus10042971 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.