Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25720 97 / 7e-27 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032479 [exp] 156 / 4e-50 AT2G25720 108 / 1e-31 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G068400 [exp] 102 / 2e-29 AT2G25720 110 / 1e-32 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042976 pacid=23168228 polypeptide=Lus10042976 locus=Lus10042976.g ID=Lus10042976.BGIv1.0 annot-version=v1.0 ATGTCGGATCCGTACGAGAGAACGAAAGCAGGCAGGCTGTCCTTTAAGGGAGGGGAAGTCGCCGTTACTAGTAAAGCCATCTCCAAAAAGAAGAAGAAAG CAAAGAAACAGCAGCACGCCGCGGAATTGAACCACGGCGGCGATGGGAAAGAGCATTTGGAAAGCGATGGCGGCGCTGCAGTAACAGCAGCAGGAGGAGG AGGAGGAGAAGGAGCTAGCGATGGCGCCGAATTAGTTTATACCATTGACGCGGCGAAGAAGAAGAAGTACGAGGATCTTTTCCCTGTGGAGGCGAAGAAA TTCGGGTACGATCCTAAGGCCAAGGAGAAGAAGGTCGAGGAGGCTCTGGACGATCGCGTCAAGAAGAAGGCTGATCGCTACTGTAAATGA
AA sequence Show only first row Show all	>Lus10042976 pacid=23168228 polypeptide=Lus10042976 locus=Lus10042976.g ID=Lus10042976.BGIv1.0 annot-version=v1.0 MSDPYERTKAGRLSFKGGEVAVTSKAISKKKKKAKKQQHAAELNHGGDGKEHLESDGGAAVTAAGGGGGEGASDGAELVYTIDAAKKKKYEDLFPVEAKK FGYDPKAKEKKVEEALDDRVKKKADRYCK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G25720			unknown protein		Lus10042976 [exp]	0	1
AT4G34630			unknown protein		Lus10028793 [exp]	5.1	0.8001
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10040307 [exp]	6.8	0.8071
AT5G47890			NADH-ubiquinone oxidoreductase...		Lus10003023 [exp]	8.5	0.7873
AT1G33520		MOS2	modifier of snc1, 2, D111/G-pa...		Lus10004541 [exp]	11.3	0.7667
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10023428 [exp]	14.3	0.7911
AT5G38250			Protein kinase family protein ...		Lus10038814 [exp]	15.5	0.7475
AT5G49210			unknown protein		Lus10043148 [exp]	16.1	0.7136
AT5G51880			2-oxoglutarate (2OG) and Fe(II...		Lus10038893 [exp]	19.1	0.7841
AT4G28440			Nucleic acid-binding, OB-fold-...		Lus10013989 [exp]	20.5	0.7762
AT3G12800		SDRB, DECR	short-chain dehydrogenase-redu...		Lus10031170 [exp]	21.6	0.7788

Compare expression of checked genes

Lus10042976 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.