Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07610 56 / 3e-10 F-box family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G232700 [exp] 41 / 4e-05 AT5G07610 117 / 3e-31 F-box family protein (.1) Potri.018G132800 [exp] 40 / 9e-05 AT5G07610 158 / 1e-43 F-box family protein (.1) Potri.013G065500 [exp] 37 / 0.0008 AT5G07610 155 / 6e-43 F-box family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042990 pacid=23168118 polypeptide=Lus10042990 locus=Lus10042990.g ID=Lus10042990.BGIv1.0 annot-version=v1.0 ATGAAGTATCGAGTCAATCTCGATACGGTTGTGGCTGCTTATCCTGAGATGAAGCAAAGTTTCCGGGATCCATCGAGCTTGCATTACTATTTGTACGATA TACTTGGTGTGTATTCTAGAGAAGGGAACGACGACAAAGACTATATGGTGCTTCATTTCCCGGGTAAAATCTTGCGATTTAGCCTCGGGGATATGAGCTT CAGGGAGATTTGTGATTTCAACCCGAGTAGTGGAGTTGTGGTTGGTGGTTGCGTTAGGACTTACAGATGGTATTCTGTTTTCCAGTTTGTTCAAACCTTT TCAAGTGTTTGA
AA sequence Show only first row Show all	>Lus10042990 pacid=23168118 polypeptide=Lus10042990 locus=Lus10042990.g ID=Lus10042990.BGIv1.0 annot-version=v1.0 MKYRVNLDTVVAAYPEMKQSFRDPSSLHYYLYDILGVYSREGNDDKDYMVLHFPGKILRFSLGDMSFREICDFNPSSGVVVGGCVRTYRWYSVFQFVQTF SSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G07610			F-box family protein (.1)		Lus10042990 [exp]	0	1
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10006840 [exp]	9.3	0.6977
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10039772 [exp]	13.4	0.6294
AT2G34080			Cysteine proteinases superfami...		Lus10035292 [exp]	18.2	0.6418
AT5G50220			F-box family protein (.1)		Lus10015170 [exp]	21.0	0.6390
AT1G68390			Core-2/I-branching beta-1,6-N-...		Lus10035828 [exp]	21.2	0.6169
AT5G46940			Plant invertase/pectin methyle...		Lus10031483 [exp]	26.7	0.5745
AT4G15390			HXXXD-type acyl-transferase fa...		Lus10017702 [exp]	32.0	0.6070
AT3G06080		TBL10	TRICHOME BIREFRINGENCE-LIKE 10...		Lus10034039 [exp]	39.5	0.5530
					Lus10019981 [exp]	40.6	0.5707
AT1G76340		GONST3	golgi nucleotide sugar transpo...		Lus10034674 [exp]	42.7	0.5508

Compare expression of checked genes

Lus10042990 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.